KEGG   Sphaerobacter thermophilus: Sthe_0645Help
Entry
Sthe_0645         CDS       T01128                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00330  Arginine and proline metabolism
sti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sthe_0645
Enzymes [BR:sti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sthe_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACZ38082
UniProt: D1C1G5
Position
1:712641..713594
Genome map
AA seq 317 aa AA seqDB search
MGRYEPINALESPRFSGLRTFARLPHVRDLAGVDVAVFGIPFDTATTFRTGARFGPAAVR
EMSAMLRTYNPSLDVNVYDYLSVVDYGDLPTVPGYIEDTYDRVVAAMEPILAENVFPVGI
GGDHSVTLAELRAIARRYGPVGFIQFDSHGDTWDEYFGRKYNHGTPFRRAVEEGLIDTSR
AIQVGMRGSLYGPGDLQQSRDLGFELWTTDDVRREGLPAVLEAIRRRVGSGPVFLTFDID
FVDPSFAPGTGTPEIGGFTSREAQELVRGLVGIDFVGMDLVEVLPAHDPSGITALIAANV
IFEFLSVLAVNRRERAR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgctacgaaccgatcaacgctctggagagcccgcgcttcagcggactgcgcacc
ttcgcccgcttgccgcatgtgcgcgatctggcgggcgtcgacgtcgcagtgttcggcatc
cccttcgacaccgccaccaccttccgcacgggagcccgcttcgggccggctgcggtgcgc
gagatgtcggccatgctgcgcacctacaacccgtcgctcgacgtcaacgtgtacgactat
ctctcggtggtggactacggcgatctgccgacggtcccgggctacatcgaagacacctac
gaccgggtcgtcgcggcgatggagccgatcctggcggaaaatgtgttcccggttgggatc
ggcggtgaccactcggtgacgctggccgaactgcgggcgatcgcgcggcgctacgggccg
gtgggctttatccagttcgactcgcacggtgacacctgggacgagtatttcgggcggaag
tacaaccacggcacccccttccgccgggcggtggaggaggggctgatcgacacgtcccgg
gccatccaggtcggcatgcgcggttcgctctacgggccgggggacctgcagcagtcgcgc
gacctcggcttcgaactctggaccaccgacgacgtgcgccgcgaggggctgcccgccgtg
ctggaagcgatccggcggcgggtcgggtccggcccggtcttcctgacgttcgacatcgac
ttcgtcgatcccagcttcgctcccggcaccgggacaccggagatcggtggcttcaccagt
cgcgaggcgcaggagctggtgcgtggactggtggggatcgacttcgtgggcatggacctc
gtcgaggtgctgccggctcacgacccaagtgggatcaccgcgctgattgccgccaatgtc
atcttcgagttcctgagcgtgctggcggtcaaccggcgcgagcgcgcccgctag

DBGET integrated database retrieval system