KEGG   Sphaerobacter thermophilus: Sthe_1091Help
Entry
Sthe_1091         CDS       T01128                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00500  Starch and sucrose metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sthe_1091
Enzymes [BR:sti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sthe_1091
Exosome [BR:sti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sthe_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACZ38527
UniProt: D1C2R0
Position
1:complement(1190475..1192445)
Genome map
AA seq 656 aa AA seqDB search
MPNEIDRRSTSLPPAAGPSPAASPSLLSADDLYLFNEGSHLRLYEHLGAHTIVVGDVPGT
YFAVWAPNAERVAVIGDFNGWDPTRHLLRPREQSGIWEGFIPGVGHGALYKYHIVSRYHG
YEVDKTDPFAFFTEVPPKTASIVWDLDYTWGDQEWMATRGARNAADAPIAIYEVHLGSWM
RVPEEGNRSLSYRELAPRLTDYVTRMGFTHVEFLPVMEHPFFGSWGYQITGYFAPSSRYG
TPQDFMFLVDYLHQHGIGVILDWVPSHFPTDDFGLAFFDGTHLYEHADPRKGFHPDWNSY
IFNYGRNEVRSFLLSNALFWLDRYHADGLRVDAVASMLYLDYSRKPGEWIPNEHGGRENL
EAISLLRRLNEEVYRHYPDVQTIAEESTAWPMVSRPTYVGGLGFGMKWDMGWMHDTLSYM
ARDPIHRRYHHHELTFRMIYAFTENFVLPLSHDEVTHGKGSLLGKMPGDDWQKFANLRLL
LTYMWAQPGKKLLFMGGEFGQWQEWNHDGSVQWDLIQYAPHQGIQRLVEDLNRLYREQPA
LHERDFDPEGFAWIEANDAEQSVVTFLRRGRAEVSEIVAAFNFTPVPRHNYIIGVPRFGR
WREILNSDATVYGGSGQGNLGGVTANPVPSHGYTQSITITIPPLGAVLFAPDEARQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaacgagatcgaccggcgatcgacgtccctaccgcccgcggcggggccgtccccg
gcagccagcccgtcgctgctgagcgccgacgacctctacctgttcaacgagggctcccac
ctgcgcctctacgagcatctcggcgcgcacaccatcgttgtgggggatgtgcccggcacc
tactttgcggtctgggccccgaacgccgagcgggtcgctgtgatcggcgacttcaacggc
tgggaccccacccgtcacctcctccgaccacgcgaacagtcgggcatctgggaggggttc
atcccgggggtcggacacggtgccctctacaagtaccacatcgtctcgcgttaccacggc
tatgaagtcgacaagaccgacccgttcgccttcttcaccgaggttccgcccaagacggca
tcgattgtctgggatctcgactacacctggggcgatcaggagtggatggcaacccgtggc
gcccgcaatgctgccgacgcgccgatcgcgatctacgaggtccacctgggctcctggatg
cgcgtccctgaggaggggaaccgctcgctgagctaccgcgagctggcgccgcggctcacc
gactacgtgacccgcatgggcttcactcacgtcgagttcttgccggtcatggagcacccc
ttcttcggctcgtggggctaccagatcaccggctacttcgccccgtccagccgctacggc
acgccccaggacttcatgttcctggtggactacctgcaccagcacggcatcggcgtgatc
ctcgactgggtaccgtcccacttccccactgacgacttcggcctggccttcttcgacggc
acgcacctctacgagcacgccgacccgcgcaaggggttccacccggactggaacagctac
atcttcaactacggccggaacgaagtccgcagcttcctcctcagcaacgccctgttctgg
ctggatcgctaccacgccgacgggctgcgcgtggacgcagtcgcgtcgatgctctatctc
gactactcccggaagccaggcgaatggattcccaatgagcatggcggtcgggagaacctg
gaagccatcagcttgctgcgccgcctgaacgaagaggtctaccgacactatcccgatgtt
cagaccatcgcagaggagtcgaccgcctggccgatggtctcccgcccgacctacgtcggc
ggcctcggcttcggcatgaagtgggacatgggctggatgcacgacacactcagctacatg
gcccgcgacccgattcatcggcgctaccaccaccacgagttgaccttccggatgatctac
gccttcaccgagaacttcgtgctcccgctgtcgcacgacgaggttacccacgggaagggc
tcgctgctgggcaagatgccaggcgacgactggcagaagttcgccaacctgcgcctgctt
ctcacctacatgtgggcccagccgggaaagaagctcctcttcatgggcggcgagttcggg
cagtggcaggagtggaaccacgacggcagcgtgcagtgggacctgatccagtacgcgccc
caccagggcatccagcggctggtcgaggacctcaatcgcctctaccgcgagcagccggcc
ctgcacgaacgcgacttcgacccggagggcttcgcctggatcgaagccaacgacgccgag
cagagcgtggtgacctttctccgcagggggcgggctgaggttagcgagatcgtcgctgcc
ttcaacttcacgcccgtaccgcgccacaactacatcatcggcgtaccgcgcttcggccgg
tggcgcgagatcctcaacagcgacgcgactgtatacggcggcagcggccagggtaacctc
ggcggcgtgactgccaacccggttccgtcgcacggctacacccagtcgatcaccatcacc
attcccccgctcggggccgtgctgttcgcccccgatgaggcccggcaatga

DBGET integrated database retrieval system