KEGG   Sphaerobacter thermophilus: Sthe_1348Help
Entry
Sthe_1348         CDS       T01128                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00051  Fructose and mannose metabolism
sti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Sthe_1348
Enzymes [BR:sti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Sthe_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACZ38783
UniProt: D1C3G6
Position
1:1489228..1489929
Genome map
AA seq 233 aa AA seqDB search
MAGTIDAQALATAEESVLAAARTLVEGRVLSLSQHGNISARVPGAGAFVLTGGGTLDRLE
RHDLALLDLDGRGLRGSLTPTAREIIQMHAAIYRARADVGAIIHTHSPHITAFAIAGKPI
SPVYEAMIRFDVTEPVPVAAYGPRGSERSVRNILDVVGPRTKAVLLANHGVLVFDRDIES
AVRLVFVLEEAAEFTLKADLLGGAQEIPQDLMGEALHRRDAFAQAAQPEEAGL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaccatcgatgctcaggcccttgccaccgccgaggagagtgtgcttgccgcg
gcgcgcacgctcgtcgagggtcgcgtcctctcgctgagccagcacggcaacatcagcgcg
cgcgtccccggcgcgggcgccttcgttctgaccggcggcgggacgctggaccgattggag
cggcacgatctggccctgctcgacctcgacggacgggggctacgcgggagcctgaccccg
accgcacgtgagatcattcagatgcacgccgccatctaccgggcgcgcgccgatgtcggc
gcgatcatccacacccactcaccccacatcactgccttcgctatcgccggcaagccgatc
tcgcccgtatacgaggcgatgatccggttcgacgtgactgaaccggtacccgtggcagcc
tacggaccgcgcggctccgagcgctccgtacgcaacatcctggatgtggtcggcccgcgg
accaaggccgtcctgctggccaaccacggggtgcttgtcttcgaccgggacatcgagagc
gcagtgcgcctggtcttcgtgttggaggaggccgccgagttcaccctgaaggcggatctc
ctcggtggcgcccaggagatcccccaggacctgatgggcgaggcgctgcaccgacgcgac
gcatttgcgcaggccgcacagccggaggaggccggcctatga

DBGET integrated database retrieval system