KEGG   Sphaerobacter thermophilus: Sthe_2436Help
Entry
Sthe_2436         CDS       T01128                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00030  Pentose phosphate pathway
sti00480  Glutathione metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01200  Carbon metabolism
Module
sti_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sthe_2436
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sthe_2436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sti04147]
    Sthe_2436
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Sthe_2436
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Sthe_2436
Exosome [BR:sti04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Sthe_2436
  Exosomal proteins of colorectal cancer cells
   Sthe_2436
  Exosomal proteins of bladder cancer cells
   Sthe_2436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACZ39851
UniProt: D1C7Y0
Position
1:2707366..2708910
Genome map
AA seq 514 aa AA seqDB search
MQSATVANPLREGLPQERTPAPCAMVIFGASGDLTRRKLMPALYNLALEGLLPPGFSVVG
YARRDLEHGTFRDQMREGVNQFSRRRPVDPDMWEVFEQGISYVQGTFEDPGDYERLGQEL
RRLDRERGTQGNRIYYLATPPDQYETIVDNLGRAGLNKPGEAGGWTRLIVEKPFGRDLQS
AMVLNDRVLRIFEEEQVFRIDHYLGKETVQNILAFRFANGIFEPIWNRNYIDNVQITVAE
SIGIEGRGAYYDQSGALRDMVQNHMLQLLSVIAMEPPIAFEADAVRDEKVKALRAIRQVD
PARVDEITVRGQYSAGWVGGQPVPGYREEPNVDPNSMTETFVALKLFIDNWRWAGVPFYL
RTGKRMPRRVTEIAIQFKRVPHPLFRGAAAESLEPNVLAIRIQPDEGISLKIAAKVPGPQ
IRLRSVNMGFLYGTSFLVESPDAYERLLLDCMLGDSTLFTRRDETEAAWRPITAILEGWA
EAPPPLFPNYEAGTWGPPEADEFLARDGREWRRP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgccacagttgcgaacccgctgcgggagggtctgccgcaggagcggaccccc
gctccctgcgccatggtgatcttcggtgcatcgggtgacctgacccgccgcaagttgatg
ccggcgctctataacctggcgttggaagggctcctgccgcccggcttcagcgtggtcggc
tatgcccggcgtgatctggagcacggcacgttccgcgaccagatgcgcgagggtgtcaac
cagttctcacgccgccggccggtcgaccccgatatgtgggaggtgttcgagcaggggatc
tcctacgtccaggggaccttcgaagatccgggcgactacgagcggctcggccaggaactg
cgccgcctcgaccgcgaacgcggcacgcagggcaaccgcatctactacctggcgacgccc
cccgaccagtacgagacgatcgttgacaacctcggtcgcgccggattgaacaagccgggc
gaggcggggggctggacgcgcctgatcgtcgagaagccattcggacgggatctccagagc
gcgatggtgctcaacgaccgcgtgctccgcatcttcgaggaggagcaggtcttccggatc
gaccactacctgggcaaggagacggtccagaacatcctcgccttccgcttcgccaacggg
atcttcgagccgatctggaaccgcaactacatcgacaacgtgcagatcacggtggccgag
agcatcgggatcgaaggccggggcgcctactacgaccagtccggcgcgctgcgcgacatg
gtgcagaaccatatgctgcagctcctcagcgtcatcgccatggagccgccgatcgccttc
gaggcggacgccgtgcgggacgagaaggtcaaggcgctgcgcgccatccggcaggtcgac
ccggcacgcgtggatgagatcaccgtgcgcgggcagtacagcgccggctgggtcggcggc
cagcctgtaccaggctaccgcgaggagccgaacgtcgatcccaactcgatgactgagacc
ttcgtggccctcaagctcttcatcgacaactggcgctgggccggggttcccttctacctg
cgcaccggcaagcggatgccgcgccgggtaacggagatcgcaatccagttcaagcgcgtg
ccccacccactcttccgcggcgcggctgccgaatcgctggaaccaaacgtgctagccatc
cgaattcagccggacgagggcatctcgctgaagatcgccgccaaggtgccggggccgcag
attcgcctgcgctcggtcaacatggggttcctgtacggcacctcgttcctggttgagtcg
cccgacgcgtacgagcggctgctgctcgactgcatgctcggcgactcgacgctcttcacg
cgccgggacgaaaccgaggcagcctggcggccgatcacggcgatcctggagggctgggcc
gaggcgccgccgccgttgttccccaactacgaggcggggacgtgggggccgcccgaggct
gacgagttcctggcccgagacggccgcgagtggcgccgtccctag

DBGET integrated database retrieval system