KEGG   Sphaerobacter thermophilus: Sthe_2686Help
Entry
Sthe_2686         CDS       T01128                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00260  Glycine, serine and threonine metabolism
sti00750  Vitamin B6 metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01230  Biosynthesis of amino acids
Module
sti_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sthe_2686
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sthe_2686
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sthe_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACZ40100
UniProt: D1C8F7
Position
2:260768..261982
Genome map
AA seq 404 aa AA seqDB search
MGIPTGATVVYDDGTEETFEDVSLAEARADEGRVEYRYAYAADLLPGEPAGETGMWRYRA
LLPLEEGPIHYPLPVGGTPLVAAPGLRNRLQMPHLWVKDETRGPTGSNKDRATAMVLEHA
MRAGAQTVSCASTGNVAVSLAVGAAAAGLRAVIFVPEQVAESKLALMRLAGATVLKVREG
YDAAMRFSRRAAREFGWFDRNTGYNPATLEAKKTVAFEIWEQLGRRVPDVVVSPIGDGVT
LSALAKGFRELVACGVTTGVPRIIGVQAEGCQPVKLAWERGGQVEPVEPKTIADGIAVGQ
PLSGAAVLRDVRDSGGAFVAVSDDAMVRAIGTLAASAGILAEPAGAAAMAGLEVALEAGL
VSRDERVVVLATGTVLKNPIFPELPGAVHTVHADLDELRRALGV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggcattccgaccggcgcgacggtcgtgtacgacgacggcaccgaagagacgttcgag
gacgtgagcctcgccgaggcgcgagccgatgaggggcgggtggagtaccggtacgcctac
gccgcggacttgctgccgggtgagccggcaggagagaccgggatgtggcgctaccgtgcg
ctcttgccgctggaggaggggccgatccactacccgctgccggtcggggggaccccgctc
gtggcggctcccgggctccggaaccggctgcagatgccacacctctgggtgaaggacgaa
acgcgtgggccgaccggctcgaacaaggaccgcgccacagcgatggtgctggagcacgct
atgcgcgccggggcgcagacggtgagctgcgcctcgaccggcaacgtggcggtgtcgctg
gcagttggggcggccgcggccgggctgcgggcggtcatcttcgtgccggagcaggtcgcg
gagtcgaagctggcgctcatgcggctggccggggcgacggtgctgaaggtccgcgagggc
tatgacgcggcgatgcgcttctcgcgtcgggcggctcgcgagttcggctggttcgaccgc
aacacgggctacaacccggccacgctggaagcgaagaagaccgttgccttcgagatctgg
gagcagttgggccgcagggtgccggacgtggtggtgtcgccgatcggcgacggggtgacc
ctcagcgcgctggccaagggcttccgcgagctggtcgcctgcggcgtcaccacaggcgtg
ccccggatcatcggcgtccaggccgaggggtgccagccggtgaaactggcctgggagcgg
ggtggccaggtcgagccggtggagcccaagacgatcgccgacggaatcgcggtgggccag
ccgctgagcggggcggccgtgctgcgggatgtgcgtgattcgggcggagctttcgtcgcg
gtgagcgatgacgcgatggtgcgcgctattggcacgctggcggcgtcggcgggcatcctg
gccgagccggccggcgcggccgccatggccgggctggaagtggcgctggaggccgggctg
gtgagccgcgatgagcgggtcgtggtgctcgcgaccggcaccgtgctgaagaatccgatc
tttccggagttgcccggcgcggtacacaccgtgcacgccgatctggacgagttgcggcgg
gcgctcggagtgtag

DBGET integrated database retrieval system