KEGG   Sphaerobacter thermophilus: Sthe_2821Help
Entry
Sthe_2821         CDS       T01128                                 

Definition
(GenBank) Pyruvate carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00620  Pyruvate metabolism
sti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sthe_2821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sti02000]
    Sthe_2821
Enzymes [BR:sti01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Sthe_2821
Transporters [BR:sti02000]
 Other transporters
  Primary active transporters [TC:3]
   Sthe_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ACZ40234
UniProt: D1C8U1
Position
2:432967..434535
Genome map
AA seq 522 aa AA seqDB search
MTSRIQLIDVTLRDGNQSLWSATGIDTETVLAVAPLLDQVGFKALDFTTSTHMAISVRYH
QEDPFERIRLTSQLMPNTPLIFMTTGMRFITWEPAPRAIIRLAMQLVIKHGIRRIQIVEP
MNNMPALLEAAKIAREEGAEQVVAGLVYSISPVHTDEFYVGCAAALAGATDLIDTVYIKD
PSGLLTPERVETIVPAMRKALGSMPLEIHSHCNAGMAPLCYLRAAELGVETVHTAIPPLA
EGTSLPSITRTVANLRELGFDVDIDLEPIERISQHLFELARRKGYRIGQPLEYDVAYYRH
QVPGGMVTTLRRHLAEVGAEDRFDEVLEEIVRVRAELGYPIMVTPFSQLVATQALLNVQA
GERYASAPDEVIKYVLGRFGDPPAPIDPEVRDRVLSMPRARELDVPLEEPTLEDLRRQIG
PNLSDEELLLRWALPGEQVDAALSGKRTRPAQPVAGPYHPLKKLIAEVSKRTDITYFYLQ
KGDTRVILRRNKPAATGKGIVPDGHAEPASPPERAAGEGVRV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgcgaatccagctcatcgacgtcacgctccgtgacggcaatcagagtctctgg
agcgccaccggcattgacacggagacggtcctcgccgtcgcgcccctgctcgaccaggtg
ggcttcaaggcgctcgacttcaccaccagcacgcacatggccatcagcgtgcgctaccac
caggaggaccccttcgagcgcatccgactgaccagccagctcatgcccaacacgccgctc
atcttcatgacgaccggcatgcgcttcatcacctgggagccggcaccgcgcgcgatcatc
cgcctcgccatgcagctcgtcatcaaacacggcatccggcgcatccagatcgtcgagcca
atgaacaatatgccggcgctgctggaagcagccaagatcgcgcgtgaggaaggggcggag
caggttgtcgccggtctggtgtacagcatcagcccggtgcataccgacgagttctacgtc
gggtgcgcggccgccctggccggcgccaccgacctgatcgacaccgtctacatcaaagac
ccgtcgggcctgctgacccccgagcgagtggagaccatcgtgcccgccatgcgcaaggcc
ctcggctcgatgccgctcgaaatccactcgcactgcaatgccggcatggcgccgctctgc
tatctccgcgcggccgagctcggcgtcgagacggtgcatacagcgattccgccactcgct
gaaggcacctcgcttccgtcgatcacgcgcactgtcgcgaacctgcgggaactcggtttc
gacgtcgacatcgacctcgagccgatcgagcgcatctcgcagcacctgttcgagctcgcc
cggcgcaagggctatcggatcggtcagccgctcgagtacgacgtcgcctactaccgccat
caggtacctggcgggatggtgaccaccctgcggcggcacctcgcggaagtcggcgccgag
gatcggttcgacgaagtcctcgaggagatcgtccgcgtccgggccgagctggggtacccc
atcatggtcacccccttctcccagctcgtcgccacgcaagccctcctcaacgtgcaggcc
ggtgaacgctacgcgagcgctccggatgaggtcatcaagtacgtcctcgggcgcttcggc
gacccgccggccccgatcgaccccgaggtgcgcgaccgcgtcctctccatgccccgcgcg
cgggagctcgatgtcccgctggaagagccgaccctcgaggatctgcgccgacagatcggc
cccaacctgtccgacgaggagctgctgctgcgctgggcactgcccggggagcaggtcgac
gccgccctcagcggcaagcgcacccgaccggcacaaccggtcgccgggccgtaccacccg
ctcaagaagctgatcgccgaagtctcgaaacgcaccgacattacctatttctatctccag
aagggagacacacgggtcatcctgcggcggaacaagcccgccgcgacggggaaggggatc
gtgccggatggacacgcagagccagcatcgcctccagaacgtgctgcaggcgaaggcgtt
cgtgtttga

DBGET integrated database retrieval system