KEGG   Streptococcus salivarius JIM8777: SALIVA_0586Help
Entry
SALIVA_0586       CDS       T02089                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase)
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00900  Terpenoid backbone biosynthesis
stj01110  Biosynthesis of secondary metabolites
stj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SALIVA_0586 (mvaA)
Enzymes [BR:stj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SALIVA_0586 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CCB94917
Position
complement(593563..594834)
Genome map
AA seq 423 aa AA seqDB search
MTKLSWTGFSKKTPQERKEHLKTNALLSQENQDLLDKDQQLTLETANQMAENVIGRFTLP
FAICPDVLVDGVTYQVPMVTEEPSVVAAASYASKLIKRSGGFTTTIHDRQMIGQVALFDV
PDKDNASSKIQAASQDLIEIAKEAHPSIVKRGGGPRKLWTETKGDFLIVYLAVDTQEAMG
ANMVNTMMEALVPELENLSEGQSLMAILSNLATESLVTATCRLSTRFLSRNKEEAHDLAK
KMEMASQLAQVDPYRAATHNKGIFNGIDALVIATGNDWRAVEAGSHAYASKDGSYRGLST
WTYNQESKELVGELSLPMPIATRGGSIGLNPSASIAHDLLNHPDAKTLASIIVSLGLAQN
LAALKALTSTGIQAGHMKLQAKSLALLAGASPEEMPQVLAELLKAKHMNQETAQAILEKL
RTP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgactaaactctcttggactggtttttccaagaagacaccgcaagaacgtaaagagcat
ttgaaaacgaatgctcttttgtctcaggaaaatcaagatcttctggataaggaccaacaa
ctcacccttgaaacagccaatcagatggctgaaaatgtcattggtcgattcacactcccc
tttgccatttgcccagatgtattggtagatggtgtgacctatcaggttcccatggttacc
gaggaaccctcagttgtggctgctgcttcctacgctagcaagctcattaagcgttctggt
ggtttcacgactacaatccatgaccgtcaaatgattggccaagttgccctctttgacgtt
cctgataaggataatgcttcaagcaaaattcaagcagccagtcaggaccttatagagatt
gccaaagaggctcacccttctattgttaagcgtgggggtggccctcgcaagctctggact
gagactaaaggagacttcctcattgtctatctagccgttgatacccaagaagccatggga
gccaatatggtcaacaccatgatggaagccctggtgccagaattagaaaacctgtcagaa
ggtcaaagcctcatggctattctctcaaatctagccactgaaagtcttgtgacagcgact
tgtcgtcttagcacacgcttcctcagtcgtaataaggaagaggcacatgacctggctaag
aaaatggagatggccagccaactggctcaggtggacccctaccgagcagctacccataat
aagggaattttcaatggtatcgatgccctagttatcgcgaccggaaacgattggcgagca
gttgaggccggtagccatgcctatgcaagcaaggatggtagctaccgaggtctgtccaca
tggacttataatcaggaatctaaggaactagttggagaattatccctccccatgccaatc
gcaacccgtggcggttctatcggacttaaccctagtgcttctatcgcccatgatttgctt
aatcatccagatgccaaaaccctagccagtatcatcgtctctcttggtttggcacaaaat
ttggctgctctgaaagctctgacttcaacaggaatacaagcaggacatatgaaactccaa
gccaaatccctggctttgttagctggggccagtcctgaagaaatgcctcaagttttggct
gaacttctcaaggccaaacatatgaaccaagaaactgcacaagcaattttggagaaactc
agaaccccataa

DBGET integrated database retrieval system