KEGG   Streptococcus salivarius JIM8777: SALIVA_1693Help
Entry
SALIVA_1693       CDS       T02089                                 

Gene name
gutB
Definition
(GenBank) sorbitol dehydrogenase (L-iditol 2-dehydrogenase) (Glucitol dehydrogenase)
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:stj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALIVA_1693 (gutB)
Enzymes [BR:stj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SALIVA_1693 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SALIVA_1693 (gutB)
    1.1.1.-  
     SALIVA_1693 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: CCB95996
Position
complement(1834421..1835464)
Genome map
AA seq 347 aa AA seqDB search
MATMKAARWHAAKDVRIEEVEVPEVQPHQVKVAVKFTGICGTDLHEYLDGPIFIPTEEHV
YSGQKAPVTLGHEFSGEIVEVGSDVTRVKVGDRVTIEPILAEHNLIGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSALKAGDTAVIFGLGP
IGLLIVEALRAAGASKIFAVELSPERQAKAEELGAIVVRPEEGETVVEAIHRLTGGGADV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQEKSLKGIIAYRHIFPK
VLELMEQGYFPADKLVTKKIKLENIVEEGFVELTQDKSQIKILVEPE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgaaagcagctcgctggcatgcagcgaaagacgttcgtatcgaagaagtg
gaagtacctgaagtacaacctcatcaagtaaaagtagcggtcaagttcacgggaatctgt
ggtacggacttgcatgaatatttggatggaccaatcttcattccaacagaagaacatgtt
tattctggtcaaaaagcaccggttactttgggacatgaattctctggtgaaattgtggaa
gtcggaagtgatgtgactcgtgttaaagttggtgatcgtgtaaccatcgaaccaattctt
gcagagcacaacttgattggtgattataaccttgatccaaacttgaacttcgtcggtctc
gctgcagatggtggttttgcaaaatattgtgtccttgatggtgatcttgtccatgtaatt
ccagatagcttgagttatgaacaagccgctcttacagaacctgcagctgtagctgtttat
gctgttcgtcaatctgctttgaaagctggtgacacagcagtcatctttggcttgggacca
attggtctcttgattgttgaggcccttcgtgcagcaggcgcatcaaaaatctttgcggtt
gaattgtctcctgaacgtcaagccaaggcagaagaattgggagcaatcgttgttcgtcca
gaagaaggagaaacagtcgtagaagctatccatcgtttgacaggtggtggagcagatgtt
tcttacgaagttactggggttccagttgttttaggccaagcccttgcagctgttcataaa
gctggggaatgtatggtcgtatctatctgggaacgtgaagccaacatcaatccaaatgaa
ttcgccatccaagaaaaatctctcaaaggaattattgcctaccgtcacatcttccctaaa
gttttggaattgatggaacaaggctacttccctgctgataaattggttactaagaaaatt
aaattggaaaatatcgttgaagaaggatttgttgaattaacacaagataaatctcaaatt
aagatcttagttgaaccagaataa

DBGET integrated database retrieval system