KEGG   Streptococcus parauberis: STP_0394Help
Entry
STP_0394          CDS       T01504                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
stk  Streptococcus parauberis
Pathway
stk00670  One carbon pool by folate
stk01100  Metabolic pathways
stk01120  Microbial metabolism in diverse environments
stk01200  Carbon metabolism
Module
stk_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    STP_0394
Enzymes [BR:stk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     STP_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA PTS_EIIC_2
Motif
Other DBs
NCBI-ProteinID: AEF24842
Position
416766..418439
Genome map
AA seq 557 aa AA seqDB search
MVQSDIEIANSVEMCPITDVAQSIGIKEDALTLYGKYKAKIDARQLATLNDKKDGKLILV
TAISPTPAGEGKTTTSVGLVDALSHIGKKAVIALREPSLGPVFGVKGGAAGGGHAQVVPM
EDINLHFTGDFHAIGIANNLLAALIDNHIHHGNTLGIDSRRITWKRVVDMNDRQLRHIVN
GLQGKVNGVPREDGYDITVASEIMAILCLSESISDLKERLGKIIIGYNFQGDPVTAHDLK
AEGAMAALLKEAIHPNIVQTLEHTPALIHGGPFANIAHGCNSVLATKLALKYADYAVTEA
GFGADLGAEKFIDIKCRLSGIRPSAVVLVATIRALKMHGGIAKADLGTENVQAVLDGLPN
LDKHLENIQEVYGLPVVVAINKFPFDTDAELNAVYDACEKRNVDVVISDVWANGGAGGAE
LAEKVVALAEEENNFSFVYDETDSIETKLTKIVTKVYGGKGISLTPAAKREMNDLERLGF
GNFPICMAKTQYSFSDDAKKLGAPKDFTVKISNLKVSAGAGFIVALTGAVMTMPGLPKVP
ASEKIDIDDEGNITGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaatcagatattgaaattgcaaattcagttgaaatgtgtccgattactgatgtg
gcccaatcaattggtattaaagaggatgccttaaccctctatggtaaatataaggcaaaa
attgatgccagacaattagctacattgaatgataaaaaagatggtaagttaattttagtg
actgccatctcaccaacacctgcaggtgaaggtaaaacaacaacctcagttggtttagta
gatgccttatcacacattggtaaaaaggctgtgattgctcttagagaaccatctttaggg
cctgtatttggtgttaaaggtggtgcagctggaggaggtcatgctcaggtcgttccaatg
gaagacattaacttacactttacaggtgattttcatgctattggaatagccaataacctg
ttagctgccttaattgataaccatattcatcatggcaatacattaggtattgattcacgt
cgtatcacatggaaacgtgttgtagatatgaatgatcgtcaattgcgtcatattgtaaat
ggacttcaaggtaaagtaaatggtgttcctcgtgaagatggttacgatattactgtagct
tctgaaattatggctattctatgtttgtcagaatcaatttcagatttgaaagaacgctta
ggcaaaattattattggttacaacttccaaggtgatcccgttactgcacatgatttaaaa
gcagaaggtgcaatggcagctcttctaaaagaagctattcatccaaatattgttcagacg
cttgaacatacacctgctttaattcatggtggaccatttgcaaatattgcacatggctgt
aacagtgttttagcaacgaaattagccctcaaatatgcagattatgcagttactgaagct
ggatttggagctgacttaggtgctgaaaaatttattgatattaaatgtcgtctctctggt
attagaccatcagcggttgtcttagttgctacaattcgtgcattaaaaatgcatggtggt
atagcaaaagctgatttaggtactgaaaatgtccaagcagtcttggatggtctcccaaat
ttagataaacatttagaaaatattcaggaagtctatggtttaccagttgttgtagcaatt
aataagttcccatttgatactgacgctgaattaaatgccgtttatgatgcttgcgaaaaa
cgtaatgtcgatgttgttatttcagacgtttgggcaaatggcggagcaggtggcgctgag
ttagctgaaaaggttgttgcattagcagaagaagaaaataatttctcatttgtctatgat
gaaactgacagcattgaaacaaaattaactaaaattgttacgaaagtttatggtggtaaa
ggaatttcattaacaccagcagctaaacgagaaatgaatgatttggaaagattaggtttt
ggaaattttccaatctgcatggcaaaaacacaatattcattctcagatgatgctaaaaaa
ctaggtgcaccaaaagactttacagttaaaatatctaatctgaaagtttcagcaggagct
ggatttatcgttgcacttactggtgcagttatgactatgccaggtcttccgaaagtacct
gcaagtgaaaaaattgatattgatgatgagggcaatatcactggattattctag

DBGET integrated database retrieval system