KEGG   Streptococcus parauberis: STP_0826Help
Entry
STP_0826          CDS       T01504                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
stk  Streptococcus parauberis
Pathway
stk00051  Fructose and mannose metabolism
stk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STP_0826 (mtlD)
Enzymes [BR:stk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     STP_0826 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N CDI
Motif
Other DBs
NCBI-ProteinID: AEF25274
Position
complement(867989..869134)
Genome map
AA seq 381 aa AA seqDB search
MKKAVHFGAGNIGRGFIGEILAANGFSIQFVDVNEAIINSLNDRYAYEIEIAEDGKRHIL
VENVSGINNRLNPEEVVNAVAEANIITTAIGPNILPFIAELIAKGIQKRQADGNNNPIDV
LACENMIGGSQFLLEEVKKYLSEENEAYVEEFVGFPNAAVDRIVPAQIHEDPLFVVVEPF
NEWVVETSRMKNRDLQLEGVHYEEDLEPFIERKLFSVNSGHATSAYTGAHAGAKTILEAL
QIPAVKEQLHAVLAEIRSLLVAKWNFDEEDLVAYHNVIISRFENPFIVDDVVRVARTPIR
KLGYDERFIRPIRELKERGLSYSNLLETVAYVFKYNDPNDEQSVQLQVMLSENDLPKVVA
DVTSLEDQELINEIVASIEAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagtacacttcggagcaggaaatattggacgtggttttattggtgaaata
ttagccgcaaatggattttcaattcaatttgttgatgttaatgaagctattatcaactcc
ttaaatgacagatatgcctatgaaattgagattgctgaagatggcaaacgtcatatctta
gttgaaaatgtttcaggaattaataaccgtctcaatcctgaagaagttgttaatgcagtt
gcagaagctaatattattacaacagcaattgggccaaatatcttgccttttatagcagaa
ttaatcgcaaaaggtattcaaaaacgtcaagcagatggaaataataacccaattgatgtt
ttggcttgtgaaaatatgattggggggtcacaatttttactggaagaagtaaaaaaatac
ctttctgaagaaaatgaagcttatgtagaagaatttgttggtttccccaatgcggctgtt
gatagaattgttcctgctcagatccatgaagatccattatttgttgtcgttgaaccattt
aatgagtgggttgttgaaacaagtcgtatgaaaaatagagaccttcaattagaaggcgtg
cattacgaagaagatttggagccatttattgaacgtaaattgttctcagtaaactcaggt
catgcgacatcagcatacaccggagcacatgctggagctaaaacaattttagaagcttta
caaataccagctgttaaagaacaacttcatgctgttttagcagaaatacgttcattacta
gttgctaaatggaactttgacgaagaagacttagttgcttaccacaatgtgattattagt
cgttttgaaaatccatttattgttgacgatgttgttcgtgttgcaagaactcctattcgt
aaacttggttatgatgaacgatttatccgtccgattcgtgaactaaaagaacgtggtttg
tcttactctaatctcctcgagacagttgcttacgtatttaaatacaatgatccaaacgat
gaacaaagtgtacaacttcaagtcatgctttcagaaaatgaccttccaaaagttgtggct
gatgtgacatctttagaagatcaagaattaattaatgaaattgttgcaagtattgaagca
gtttaa

DBGET integrated database retrieval system