KEGG   Streptococcus parauberis: STP_1527Help
Entry
STP_1527          CDS       T01504                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IIB subunit
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
stk  Streptococcus parauberis
Pathway
stk00051  Fructose and mannose metabolism
stk01100  Metabolic pathways
stk02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STP_1527
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    STP_1527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stk02000]
    STP_1527
Enzymes [BR:stk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     STP_1527
Transporters [BR:stk02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    STP_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AEF25975
Position
complement(1717421..1717909)
Genome map
AA seq 162 aa AA seqDB search
MKIKLARIDDRLIHGQVATVWAKEANAERIIIPSDEVANDEIRRTLVKQAAPPGVKVNII
TTEKAIKVFQNPKYENDTVFFLFTKPSEVLELVKAGIPIQSINIGGMQYKEGRVQITKAI
SVFKEDIDAFYELEKRGVKLDCRVVATDTPKDFKALLDSVTM
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaactagcaagaattgatgacagattaattcatggtcaagttgcaactgta
tgggccaaagaagccaacgctgaaagaattatcatacctagtgatgaagttgcgaatgat
gaaatcaggagaactttggttaaacaggcagcacctccaggtgtaaaagtaaatattatt
acaactgaaaaagccatcaaggtttttcaaaatcctaaatatgaaaatgacactgtcttc
tttctgtttacaaaacctagtgaggttttagaattagtaaaagcaggtatccccattcag
tccatcaatattggtgggatgcaatataaagaaggaagagttcaaataactaaagctatt
tctgtcttcaaagaagatattgacgccttttatgaacttgaaaaacgtggtgtcaaattg
gattgccgagttgttgcaactgatacacctaaagattttaaagctttactcgattcagta
actatgtaa

DBGET integrated database retrieval system