KEGG   Streptococcus parauberis: STP_1829Help
Entry
STP_1829          CDS       T01504                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stk  Streptococcus parauberis
Pathway
stk00071  Fatty acid degradation
stk00072  Synthesis and degradation of ketone bodies
stk00280  Valine, leucine and isoleucine degradation
stk00310  Lysine degradation
stk00362  Benzoate degradation
stk00380  Tryptophan metabolism
stk00620  Pyruvate metabolism
stk00630  Glyoxylate and dicarboxylate metabolism
stk00640  Propanoate metabolism
stk00650  Butanoate metabolism
stk00900  Terpenoid backbone biosynthesis
stk01100  Metabolic pathways
stk01110  Biosynthesis of secondary metabolites
stk01120  Microbial metabolism in diverse environments
stk01130  Biosynthesis of antibiotics
stk01200  Carbon metabolism
stk01212  Fatty acid metabolism
stk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STP_1829 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    STP_1829 (thlA)
   00640 Propanoate metabolism
    STP_1829 (thlA)
   00650 Butanoate metabolism
    STP_1829 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STP_1829 (thlA)
   00072 Synthesis and degradation of ketone bodies
    STP_1829 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STP_1829 (thlA)
   00310 Lysine degradation
    STP_1829 (thlA)
   00380 Tryptophan metabolism
    STP_1829 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STP_1829 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STP_1829 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STP_1829 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stk04147]
    STP_1829 (thlA)
Enzymes [BR:stk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STP_1829 (thlA)
Exosome [BR:stk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STP_1829 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEF26277
Position
complement(2101249..2102499)
Genome map
AA seq 416 aa AA seqDB search
MLHTKEEEIVIVGAARTPVGAFLGDLKTVPVEVLGEVALKEAVKRANLTVNDIDEVIVGH
VTGSQTTNNLGNVIGINSGLPETSTGMTVNRICGSGIQSAVSATLELLHSNKKIIAAGGA
ESLSRAPYQLPDSARYQAFRLGDVKLIDANLEGHRSASGRNSGIEHMGNTAENVVRKYNI
SREKQDQFAYESQMKAAQAMNNGRFAQEIVPVEVPGRKGKVTIVEKDGHPRADTTLESLA
KLRPAFEKDGSVTAGNASGLNDGGAFEIFTTESLAKEKGLEVMARVVDYQISGCAPETMG
LGPVFAINDLLERQGMDLVKDIDVLEINEAFAGQTIGCLIELGIDMDTDFYQNKFNPHGG
AVALGHPLGMSGARIITSLLYEFKNNPDKRYAIASACIGGGQGIALLLENGYYTGK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttacatactaaagaagaagaaattgttattgttggtgcagctagaactcctgttgga
gcatttcttggtgatttaaaaactgtaccagttgaagttcttggggaagtagctttaaaa
gaagctgtaaaacgtgctaacttgactgtaaacgatattgacgaagttattgtcggtcat
gttacaggatcacaaacaacaaataacttaggaaatgttattggtattaatagtggttta
ccagaaacatcaacagggatgactgtaaaccgtatttgtggatcaggtattcagtcagca
gtttcagcaactttagaattacttcattctaataaaaaaatcatcgcagctggtggtgca
gaatcactatcacgtgcaccttatcaattacctgacagtgctcgttaccaagctttccgt
ttaggtgatgttaaattaattgatgctaacttagaaggtcaccgttctgcatcaggtcgt
aactctggcattgaacacatgggaaatacagcagaaaatgttgttcgtaaatacaatatt
tctcgtgaaaaacaagatcaatttgcttatgagtctcaaatgaaagcagctcaagcgatg
aataatggtcgctttgctcaagagattgtaccagttgaagttccaggacgtaaaggtaaa
gttactattgttgaaaaagatggtcatccacgtgcagatacaaccttagaaagcttagct
aaactaagacctgcatttgagaaagatggatctgtaactgcaggtaatgcatctggttta
aatgatggtggagcatttgaaatcttcactactgagtcacttgcaaaagaaaaaggcctt
gaagtaatggcgcgtgttgtagattatcaaatctctggttgtgctcctgaaacaatggga
cttggtccggtatttgctattaatgacttgttagaacgccaaggaatggatttagttaaa
gatattgatgtattagaaatcaatgaagcttttgcaggtcaaacaattggttgcctaatt
gaacttggaattgatatggatactgacttctatcagaataaatttaatccacacggtggt
gcagttgctttaggacacccacttggtatgtctggagcacgtattattacatcacttcta
tatgaatttaaaaataaccctgacaaacgttatgctattgcttcagcatgtatcggtggc
ggacaaggaattgctctattgttagaaaatggttattacacaggaaaataa

DBGET integrated database retrieval system