KEGG   Streptococcus thermophilus LMG 18311: stu0735Help
Entry
stu0735           CDS       T00213                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein
  KO
K03531  cell division protein FtsZ
Organism
stl  Streptococcus thermophilus LMG 18311
Brite
KEGG Orthology (KO) [BR:stl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:stl03036]
    stu0735 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:stl04812]
    stu0735 (ftsZ)
   02048 Prokaryotic Defense System [BR:stl02048]
    stu0735 (ftsZ)
Chromosome and associated proteins [BR:stl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    stu0735 (ftsZ)
Cytoskeleton proteins [BR:stl04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   stu0735 (ftsZ)
Prokaryotic defense system [BR:stl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    stu0735 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AAV60428
UniProt: Q5M4X8
Position
694747..696069
Genome map
AA seq 440 aa AA seqDB search
MSFSFDSASVQGAVIKVIGVGGGGGNAINRMIEEGLSGVEFIAANTDIQALSSSKAETVI
QLGPKLTRGLGAGGQPEVGRKAAEESEETLTEALTGADMVFITAGMGGGSGTGAAPVIAR
IAKSLGALTVAVVTRPFGFEGNKRSSFAIEGIQELREQVDTLLIISNNNLLEIVDKKTPL
LEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTVMANKGNALMGIGIGSGEERIVE
AARKAIYSPLLETTIDGAEDVIVNVTGGLDMTLTEAEEASEIVGQAAGNGVNIWLGTSID
DTLKDEIRVTVVATGVRQERAEKVSGMKAQPRKVTTAPSQSSVPNQQVAQEQQRLGSQAS
FERQPNFDYNETHSMSQPGVRPTMAAPQQEQSAFGNWDLRRDNISRPKTGELDSQLTMST
FSSDVEDDDELETPPFFKNR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcatttgatagcgcatcagttcagggtgcggtaattaaagttattggtgtc
ggtggaggtggaggaaatgccatcaaccgaatgattgaagaaggtctttctggtgttgaa
tttattgcagctaacacggatattcaagcgctcagctcttctaaagcagaaacagttatc
caattaggtcctaaattgactcgtggtcttggtgctggaggtcaacctgaagttggtcgt
aaagcagctgaagaaagtgaagaaacacttacagaggcacttacaggagctgatatggta
tttatcactgctggtatgggtggtggttctggtacaggggcagcaccagttattgcacgt
attgcgaaaagcttgggtgcattgacagtagcagtggttacgcgtccatttggatttgaa
ggtaataagcgtagttccttcgctattgaaggtattcaagaattgcgtgaacaagttgat
actcttcttattatctctaacaacaaccttcttgaaatcgttgataagaaaactccactt
cttgaagcccttagtgaagcagataatgtcctacgccaaggggtacaaggtattacagac
cttattaccaacccaggtttaatcaacctcgactttgctgatgtgaaaacagttatggca
aataaaggcaatgcgcttatggggattggtattggttctggtgaagaacgtattgttgaa
gctgcacgcaaagcaatctattcaccgcttcttgaaacaactatcgatggtgcagaagat
gttatcgttaacgtaactggtggccttgatatgacacttacagaggcagaagaagcatct
gaaatcgttggtcaagctgctggtaacggtgttaatatttggcttggtacatcaatcgat
gatactttgaaagatgaaattcgtgtaacggttgttgcaacgggggttcgtcaagagcgt
gctgaaaaggtatctggtatgaaagctcaaccacgcaaagtgactacagctccttcacaa
tcgtcagttcctaatcagcaagttgctcaagaacaacaacgtctaggttctcaagcttca
tttgaacgtcaaccgaatttcgactacaatgaaacacattcaatgtcacaaccaggcgtt
cgtccaactatggcagcacctcaacaagagcaatcagcttttggaaactgggacttgaga
cgtgataatatttctcgtcctaagacaggtgaacttgatagtcaattgactatgtctaca
ttctcaagtgatgttgaagatgacgatgaattggagacaccaccattctttaaaaaccgt
taa

DBGET integrated database retrieval system