KEGG   Streptococcus thermophilus LMG 18311: stu0922
Entry
stu0922           CDS       T00213                                 
Name
(GenBank) Unknown, predicted membrane protein (TMS11)
Organism
stl  Streptococcus thermophilus LMG 18311
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: AAV60588
UniProt: Q5M4L1
Position
838860..840008
AA seq 382 aa
MSIYFNRFSSLISEYGYTILINILLSRISVQLVMYFWVVKCLAAIVTNRINISNSKLSRK
YLLILLEITKAILLFLLGFGLNHIIVLLVVFIIEVVNVLFSSLLYSCVPIIIDKDSLIKF
NARYTSIGSVSYFLAPLFVGLFINKSHFLLFAVYALLLIVGATSLLFLPNISTLNLKEER
KKQNLNITLFNILRSKKIALVLLSGVIVGSIGVVYDTYEVVYLTKYLGISDSMYSFSLSF
LAVSFLVMSFLLSFVKQISSHMKAFALGLSFYVLYLLLFSTSSNIYTVLMSYVFLAIGQT
MMGIIETNYFQLSLNMKELQKLYIYSETLHSVFSGIAVLVIGSFAFLSSHLVLVFRSLAV
FALFILLCYCVFVNLKKLSIDK
NT seq 1149 nt   +upstreamnt  +downstreamnt
ttgagtatttattttaatcgtttctcatcgttaatctcagagtatggttatactatcttg
atcaacattctattgtctagaatttctgtgcaattagttatgtatttttgggtggtaaag
tgtttagctgcaatagttacaaataggattaatatctcaaatagtaaactgagcagaaaa
tacctgcttattctgttagaaattacaaaggcaatcttacttttcttactaggttttgga
ttaaaccatataattgtcctattagttgtattcataattgaggttgtcaatgtattgttt
tccagtttattatatagttgtgtaccaattattatagacaaggattcattgattaagttt
aacgctaggtatacaagcattggttcagtatcttattttttagcaccgttgtttgttggt
ttatttattaataaaagtcactttttattgtttgcagtttatgctcttcttttgatagtg
ggagctactagtcttttatttttaccaaatatttcgactttaaatttgaaagaagaaaga
aaaaaacaaaatttaaacattacattatttaacattctgagatccaaaaaaattgcatta
gttctattatctggagttattgtgggatcaattggagttgtttatgatacttatgaagtt
gtttatttaacaaagtatctcggtattagtgattctatgtattccttttccttatcattt
ttagcagtttcattcttagtaatgagcttccttcttagcttcgtgaaacaaataagttct
catatgaaagctttcgccttaggtctttcattttatgttctatatctacttttatttagt
acatcttcgaacatttatacagtactaatgagttatgtttttctagcgataggtcagaca
atgatggggataatcgaaaccaattattttcagttgtcacttaacatgaaagaattacag
aaactatatatttactcggagaccttacattctgtattttcaggcattgctgttttagta
ataggaagttttgcctttttaagtagtcatcttgttttagttttcagaagtcttgctgtt
tttgctctgtttattcttctgtgttattgtgtgtttgtaaacctcaaaaaactaagcatt
gataagtaa

DBGET integrated database retrieval system