KEGG   Streptococcus thermophilus LMG 18311: stu1490Help
Entry
stu1490           CDS       T00213                                 

Gene name
rpsU
Definition
(GenBank) 30S ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:stl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    stu1490 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:stl03011]
    stu1490 (rpsU)
Ribosome [BR:stl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    stu1490 (rpsU)
  Bacteria
    stu1490 (rpsU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21
Motif
Other DBs
NCBI-ProteinID: AAV61094
UniProt: Q5M3E1
Position
complement(1314377..1314583)
Genome map
AA seq 68 aa AA seqDB search
MLLYLEEVNSMSKIVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSE
AARKRKKI
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgttactttatcttgaggaggtgaattcaatgtcaaaaatagtagtacgtaaaaacgaa
tcacttgacgacgctcttcgtcgtttcaaacgttctgtgactaaagctggtactcttcaa
gaggctcgtaaacgtgaacattacgaaaaaccttctgtaaaacgtaaacgtaaatcagag
gcagctcgcaaacgtaaaaaaatctaa

DBGET integrated database retrieval system