KEGG   Streptococcus thermophilus LMG 18311: stu1540Help
Entry
stu1540           CDS       T00213                                 

Gene name
folK
Definition
(GenBank) hydroxymethylpterin pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00790  Folate biosynthesis
stl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    stu1540 (folK)
Enzymes [BR:stl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     stu1540 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AAV61143
UniProt: Q5M395
Position
complement(1357026..1357517)
Genome map
AA seq 163 aa AA seqDB search
MTKVYLSLGSNMGNRQDYLKKAVESLDRLLETEVKAVSSYYETAAWGLTDQADFLNLALA
LDTQLPAESLLSACQAIEKDLDRVRHEHWGPRTVDIDILLYGQEIWRTEHLKVPHPLMTQ
RAFVLVPLLEIAENLVEPQTGQAYKKYLSQIDTSDVRKLEQVD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtttatttaagtttgggatctaatatgggaaatcgtcaagactatcttaaa
aaagcggtggagtcattggatcgcttgcttgagacggaagttaaagcagtgtcctcttat
tatgagacggctgcttggggattaactgaccaggctgattttttgaatctcgctttagca
cttgacactcagttgccggctgaaagcttgctgagtgcttgtcaggcaattgagaaagat
ttagaccgcgttcgccatgagcattggggccctcgaactgtggatattgatattctttta
tatgggcaggaaatctggaggactgagcaccttaaagtgcctcatcctctcatgactcaa
agggcctttgttttggttcctctgctagaaattgccgagaatttagttgagcctcaaact
ggtcaagcctacaaaaaatatttgagtcaaatagacactagtgatgtccgcaaattggag
caagtggactag

DBGET integrated database retrieval system