KEGG   Streptococcus thermophilus LMG 18311: stu1882Help
Entry
stu1882           CDS       T00213                                 

Definition
(GenBank) alcohol-acetaldehyde dehydrogenase, truncated
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stl  Streptococcus thermophilus LMG 18311
Pathway
stl00010  Glycolysis / Gluconeogenesis
stl00620  Pyruvate metabolism
stl00625  Chloroalkane and chloroalkene degradation
stl00626  Naphthalene degradation
stl00650  Butanoate metabolism
stl01100  Metabolic pathways
stl01110  Biosynthesis of secondary metabolites
stl01120  Microbial metabolism in diverse environments
stl01130  Biosynthesis of antibiotics
stl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    stu1882
   00620 Pyruvate metabolism
    stu1882
   00650 Butanoate metabolism
    stu1882
  Lipid metabolism
   00071 Fatty acid degradation
    stu1882
  Amino acid metabolism
   00350 Tyrosine metabolism
    stu1882
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    stu1882
   00626 Naphthalene degradation
    stu1882
Enzymes [BR:stl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     stu1882
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     stu1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AAV61481
Position
complement(1683598..1684158)
Genome map
AA seq 186 aa AA seqDB search
MILAEIPDATMEHPLALEKLSPVLALIKSDGVEDGFKKAEGMLNLGGIGHTAVIHTENEE
LQLQYGIRMKACRVLVNSPSAEGGIGNIYNNMIPSLTLGCGSHGHNSILHNVSSFDLLNV
KTLSKRRNNMQWFRVPTKIFFEKDSITYLRHIEADRVMLVCDPGMVQFGYADLVKRNWNL
TAIDQQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgattttggcagaaattccagatgcaacaatggaacacccacttgccttggaaaaattg
tctccagtacttgcccttatcaaatctgatggcgttgaagatggattcaaaaaagcagaa
ggcatgctcaatttgggaggtattggacatacagctgttattcacactgaaaatgaagag
ctccaactccaatacggtatccgtatgaaagcttgccgtgtcttggtgaatagtccatcg
gctgaaggtggcattggtaatatctataacaacatgattccatcattaactcttggttgt
ggttcacacggtcataactcaattttacacaatgttagctcatttgatctcttgaatgtc
aagacattgtcaaagcgtcgcaataacatgcaatggtttcgtgtcccaacaaaaatcttc
ttcgaaaaagattcaataacttacttgcgtcacattgaagctgaccgggtgatgttggtt
tgtgaccctggtatggttcagtttggttacgctgacttggttaaacgcaattggaactta
accgccatagaccagcagtag

DBGET integrated database retrieval system