KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT072
Entry
PSLT072           CDS       T00065                                 
Symbol
finP
Name
(RefSeq) putative transglycosylase
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: SLT MMgT
Other DBs
NCBI-GeneID: 1256164
NCBI-ProteinID: NP_490559
UniProt: Q93GP2
Position
pSLT:complement(60123..60593)
AA seq 156 aa
MYKWLLSVLLVLMSTVVHAADCFDLAGRDYKIDPDLLRAISWKESRNRANAVGINPVTGY
GSGLMQVDSQHFNELARYGIKPEQLVSDPCLNIYTGAYYLAIAFRKWGVSWTAVGAYNAG
FKKTPLQDARRLDYATDVHRIWIAIKQSKTRQTPAR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtataaatggctcctgtctgtcctcctggtattaatgagcacggtagtccatgccgct
gactgttttgatctggccgggagagactataaaatagatccggatttactgcgggcgatt
tcatggaaggaatcccgtaaccgggctaatgccgtcggtattaatccggttacgggatat
ggctcggggttaatgcaggttgactctcagcactttaacgaactggctcgttatggaata
aaaccggaacaacttgtctccgatccctgcctgaatatttacaccggagcttattatctg
gcaatcgcattcagaaagtggggggtatcctggacagcagtcggagcgtacaacgccgga
tttaaaaagactccccttcaggatgcacgtcgtctggactatgcgactgatgtacaccga
atctggatcgcgataaaacaaagtaaaaccaggcagactcccgcccgatga

DBGET integrated database retrieval system