KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT073
Entry
PSLT073           CDS       T00065                                 
Symbol
traM
Name
(RefSeq) conjugative transfer: mating signal
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: Tra_M
Other DBs
NCBI-GeneID: 1256163
NCBI-ProteinID: NP_490560
UniProt: Q93GP1
Position
pSLT:61008..61388
AA seq 126 aa
MAKVNVYISNEVHNKITAIVEKRRQEGARDKDISFSGTSSMLLELGLRVYEAQMERKESP
FNQTEFNKVLLENVLKTQSSVAKILGIGSLSPHVAGNPKFEYANMVEDIKEKVSSEMERF
FHENEE
NT seq 381 nt   +upstreamnt  +downstreamnt
atggctaaagtcaatgtatatataagtaatgaggtacacaataaaataactgctattgtg
gaaaaacgacgccaggaaggggcgagagataaagatatcagtttttctggtacatcttcg
atgttgctggaattagggcttcgtgtctatgaggcacaaatggagcgtaaggagtcgcca
tttaatcagacagaattcaataaagtattacttgaaaatgtacttaaaacacagtcatcc
gtagccaaaattttaggtataggatctctcagccctcatgtcgccggaaatccaaaattt
gaatatgcaaatatggttgaagatatcaaagaaaaagtatcttcagagatggaaagattt
ttccatgaaaatgaagaataa

DBGET integrated database retrieval system