KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT076
Entry
PSLT076           CDS       T00065                                 
Symbol
traY
Name
(RefSeq) conjugative transfer: oriT nicking
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: TraY
Other DBs
NCBI-GeneID: 1256161
NCBI-ProteinID: NP_490562
UniProt: H9L430
Position
pSLT:62268..62588
AA seq 106 aa
MLIKARHFWRVFFCRFPCNHKFISRVSRGEFVRRRNAREGISRTVSVYLDEDTNNRLIRA
KDRSGRSKTIEVQIRLRDHLKRYPDFYNEEIFREVIEETESTFKEI
NT seq 321 nt   +upstreamnt  +downstreamnt
atgttaattaaggcgcgccatttttggcgtgtttttttttgccgttttccgtgtaatcat
aagtttattagtcgtgtaagcagaggtgaatttgtgaggaggagaaacgcaagagagggg
ataagtcgaactgtctcagtgtatctcgatgaagatacgaataaccgtcttatcagggct
aaagatcggagtggaagaagtaaaacaatagaagttcagattcgtctgagggatcatctg
aaacgatatccggatttctataatgaagaaattttcagggaggtaattgaagaaacagag
tccacatttaaagagatttaa

DBGET integrated database retrieval system