KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT077
Entry
PSLT077           CDS       T00065                                 

Gene name
traA
Definition
(RefSeq) conjugative transfer: fimbrial subunit
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: TraA
Other DBs
NCBI-GeneID: 1256159
NCBI-ProteinID: NP_490563
UniProt: H9L4B7
Position
pSLT:62630..62992
AA seq 120 aa
MSAILSVQGASAPVKKKSFLSTFTRLNLLKLARAVIPAAVLIFFFPQLAMAAGGSQDLMA
SGNGTVKATFGKDSSAVKWVILAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagcgctattttaagtgttcagggtgcttctgcgcccgttaaaaagaaatcgtttctg
tctacgttcacacgtctgaacctgctgaaacttgcccgcgcagtgatcccggcggcagta
ctgatattctttttcccgcaactggcaatggctgccggcggttcgcaggacctgatggcc
agcggtaacggtacggtcaaggcgacatttggtaaggattccagcgccgtcaagtgggtt
attctcgcggaagtgctggtcggtgccgtgatgtacatgatgaccaagaacgtcaaattc
ctggcgggttttgccatcatctcggtctttattgccgttggtatggctgtcgtcggcctc
tga

DBGET integrated database retrieval system