KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT078
Entry
PSLT078           CDS       T00065                                 
Symbol
traL
Name
(RefSeq) conjugative transfer: assembly
  KO
K12068  conjugal transfer pilus assembly protein TraL
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT078 (traL)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT078 (traL)
SSDB
Motif
Pfam: TraL
Other DBs
NCBI-GeneID: 1256160
NCBI-ProteinID: NP_490564
UniProt: H9L485
Position
pSLT:63007..63318
AA seq 103 aa
MSGDENKLRKYRFPETLTNQSRWFGLPVDELIPAAVCIGWGLMTSKQLFGISAAVLVYFG
IRKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtcgggagacgagaataaactcaggaaatatcgtttcccggaaacactgaccaaccag
agccgctggtttggcctgccggtggatgaattaattcctgctgctgtctgtattggctgg
ggattaatgacatcaaaacaacttttcggcatcagcgctgcggttctggtttatttcggg
ataagaaaactgaaaaaagggcggggaagctcctggctgcgtgacctgatttactggtat
atgccgacagccctgcttcgcggtatttttcataacgttcccgattcgtgtttccggcag
tggattaagtaa

DBGET integrated database retrieval system