KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT079
Entry
PSLT079           CDS       T00065                                 
Symbol
traE
Name
(RefSeq) conjugative transfer: assembly
  KO
K12067  conjugal transfer pilus assembly protein TraE
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT079 (traE)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT079 (traE)
SSDB
Motif
Pfam: TraE Hexokinase_1 Nup_retrotrp_bd
Other DBs
NCBI-GeneID: 1256158
NCBI-ProteinID: NP_490565
UniProt: H9L421
Position
pSLT:63340..63906
AA seq 188 aa
MEHGARLSTSRVLAISFIFMALLIVLSLAVNVIQGINNYRLQNEQRTAVTPMGFNASFAV
SQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRSGAQNQMKVILAEEARRIK
ADNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNF
GETDDEKK
NT seq 567 nt   +upstreamnt  +downstreamnt
atggaacacggcgcccgtttaagtaccagccgcgtactggcaataagttttatttttatg
gccctgctgattgtgctcagtctggccgtgaatgtcattcagggtattaataactaccgg
ctgcagaatgagcaacgcacggcggtcactcctatgggatttaacgcgtcctttgcggtg
tcacagaacagtgccgatgcctcttatttacagcagatggcgctgtcgtttattgccctg
cgtctgaatgtgtcgtcagaaaccgtcgacgcgtcacaccaggcacttctgcaatatatt
cgttcgggcgcacagaaccaaatgaaagtcattctggcagaagaagcgagacgaattaag
gccgacaacgttaactccgcttttttccagaccagtgtcagggtctggccacagtatggc
cgcgtggaaattcgcggtgtgctgaaaacctggattggagattcaaaaccgtttaccgac
atcaaacattacattcttattctgaaacgggaaaacggcgtgacctggctggataatttc
ggggaaactgacgatgagaaaaaataa

DBGET integrated database retrieval system