KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT081
Entry
PSLT081           CDS       T00065                                 
Symbol
traB
Name
(RefSeq) conjugative transfer: assembly
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT081 (traB)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT081 (traB)
SSDB
Motif
Pfam: TrbI CALCOCO1 FTA4 Lebercilin ATG16
Other DBs
NCBI-GeneID: 1256155
NCBI-ProteinID: NP_490567
UniProt: Q93GN9
Position
pSLT:64633..66054
AA seq 473 aa
MASINTVVKRKQYIWLGIVAVGAAAAIGGGLYLSDVDMSGNGTAAEQEPVPDMTGVVDTT
FDDKVRQHATTEMQVTAAQMQKQYDEIRHELDVLNKQRGDDQRRIEKLGQDNAALAEQVK
ALGANPVTTTGEPVPHTPVSPPGPEGEPQPGNTPMTFPPQGAVPPPTAFYPGNGVTPPPQ
VTYQSVPVPNRIQRKTFSYDAAAKKGPSLPYIPSGSFAKTMLIEGADANASVTGNESTVP
MQLRITGPVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVRTRNISCLKDGKTIDMSVKGH
VSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQQAVGLGATATYGAGDVFR
MGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMAQEQARH
RKEDENAESPVPIPPSVDSHMNGFNTDQMLKQLGDLNPQQFMSGSQGGHVNGK
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgagcatcaatacggttgtaaagcgtaaacagtacatctggctggggattgttgcg
gtgggggctgccgctgccattggcggaggcctttacctgtctgacgtcgacatgagtggc
aacgggacggccgcagagcaggagccggtaccggatatgaccggggtggtggacacgacc
tttgatgacaaagttcgtcagcatgccaccacggaaatgcaggtgacggcggcgcagatg
cagaaacagtacgacgaaatccgccatgagctggatgttctgaataagcagcgcggtgac
gaccagcgtcgtattgagaagctggggcaggacaacgccgccctggccgaacaggtgaag
gccctgggagcgaacccggtgacgaccacaggagagcccgtgccgcatacacctgtctca
ccgcccggtccggaaggagaacctcagccgggtaatacgccgatgaccttcccgccacag
ggagccgttcctccgccaaccgctttttatccggggaatggcgtcacgcctccgccacag
gtgacataccagtccgtgccggtgccgaaccgtatacagcgtaaaacgttcagctatgac
gctgccgcgaagaaaggtccctccctgccgtatatcccgtccgggagttttgcaaaaacc
atgctgatcgaaggagcggatgccaatgcctccgtcaccggtaatgaatcgacggtccct
atgcagttgcgcattaccggcccggtggagatgccgaacagtaaaacatatgacctgaca
gggtgctttgtgggtctggaagcctggggggatgtgtccagtgaacgcgcgatagtacgt
acccgtaatatcagctgcctgaaggacggcaaaaccatcgacatgtcggttaagggacat
gtcagcttccgtggaaagaacggcatcaagggtgaagtggtgatgcgtaatggcaaaatc
ctcggctgggcgtggggcgccggttttgtggacggtatcggccaggggatggagcgggca
tcccagcaggcggtggggctgggggccactgcgacttacggcgcgggcgatgtgttcaga
atggggattggtggtggtgcatcgaaagcggcacagacactcagtgattattacatcaaa
cgtgccgagcagtatcacccggtgatcccgattggtgccggtaatgaagtgaccgtggtg
tttcaggacggttttcagctgaaaaccgtggaagaaatggcacaggagcaggcccgtcac
cggaaggaggatgaaaatgcggaaagcccggtgcctatacctccgtcagtcgacagccat
atgaacggctttaacaccgaccagatgctgaagcagctgggtgacctgaatccacagcag
tttatgtccggcagccagggaggacatgtaaatgggaaataa

DBGET integrated database retrieval system