KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT084
Entry
PSLT084           CDS       T00065                                 
Symbol
traV
Name
(RefSeq) conjugative transfer: assembly
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT084 (traV)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT084 (traV)
SSDB
Motif
Pfam: TraV LPAM_1
Other DBs
NCBI-GeneID: 1256153
NCBI-ProteinID: NP_490570
UniProt: Q93GN6
Position
pSLT:66860..67375
AA seq 171 aa
MNRISCLIPFCGALLLSGCAGTNSDFECTATTSDTCMTMEQANEKAKRQEQPETVKPGAV
SLPRLAEGNFRTTPVQVVSTVTLPVAKTVAAPRSGQKPPAPHPLFTAAREVKPVAAVSTV
SPVVPPRPLRTREQTAALWIAPYIDSQDIYHQPSGVFFVIKPSVWGKPRIN
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaaccggatttcatgcctgatccctttctgtggcgcgcttctgctgtccggatgcgcc
ggaacgaactccgactttgaatgtaccgccaccacgtcagacacctgtatgacgatggag
caggccaatgaaaaagcgaaaagacaggagcaacctgagacggtaaagccgggtgcggta
tcactgccgcgcctggctgagggtaactttcgcacgacgccggtacaggtagtcagtacc
gtcactctacccgtcgcaaagaccgtggccgccccgcgttccgggcagaaaccgccggca
ccacacccgctgtttacggctgcccgggaggtgaaaccggtggcggctgtcagtacggtc
tctcctgtggtgccgccccgtccactgagaaccagggagcagacggcggcgttatggata
gcgccctatattgacagccaggatatttaccatcagccgtccggcgtattttttgtcatt
aaaccgtccgtgtggggaaagccacggattaattaa

DBGET integrated database retrieval system