KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT088
Entry
PSLT088           CDS       T00065                                 
Symbol
traC
Name
(RefSeq) conjugative transfer: assembly
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT088 (traC)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT088 (traC)
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF5934 DUF87 AAA_10 TrwB_AAD_bind DUF758 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 1256150
NCBI-ProteinID: NP_490573
UniProt: Q93GN3
Position
pSLT:68587..71235
AA seq 882 aa
MKNLLDTVTQAANSLLTALKLPDESAQANQILGEMSFPQFSRLLPYRDYNQESGLFMNDA
TMGFMLEATPVNGANETIALSLDHLLRTKLPRGIPLCVHLMSSQLVGERIEYGLRKFSWS
GEQAERFNAITRAYYMKAAETHFPLPEGMNLPLTLRHYRVFISYCAPSRKKSRADILEME
NLVKIIRASLQGAYISTQTVDAKAFINIVGEMINHNPESIHPTRRRLDPYSDLNYQCVDD
SFDLKVRQDYLTLGLRDNGKNSTARIMSFHLARNPEIAFLWNSADNYSNLLNPELSISCP
FILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGDLRQRLASNQS
SVVSYFFNITAFCRDNKETALETEQDILNSFRKNGFELISPRFNHMRNFLACLPFMAGKG
LFKQLKEAGVVQRAESFNVTNLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNY
NMAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNP
FANITNIDQSAERIRDQLSVMASPNGNLDEVHEGLLLQAVRAAWLTKKNRARIDDVVDFL
ENARTSEQYAESPGIRSRLDEMIVLLNQYTAAGTYGRYFNSDEPSLRDDARMVVLELGGL
EDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWRLLDFKNRKVGDFIEKGYRTA
RRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYNQLYPDQFPQL
HREMIEKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLQEHETFRGTYEYKAETD
NT seq 2649 nt   +upstreamnt  +downstreamnt
gtgaagaacctgcttgatactgtcactcaggcggccaactcgctgctgaccgcgctgaag
ctgccggatgaatcggcacaggccaatcagatcctcggcgagatgagcttcccgcagttc
agccgtctgctgccgtaccgggactataaccaggagtccggcctgttcatgaatgacgcc
acgatgggctttatgctggaagccacgcctgtcaacggcgctaacgagaccattgcgctc
tcccttgaccatctgctgcgtaccaaactgccgcgcgggatacccctgtgtgtccacctg
atgtccagccagctggtcggggagcgtattgagtacgggctgcggaagttctcctggtcc
ggtgagcaggcggagcggttcaacgccatcacccgcgcctactacatgaaagccgcagag
actcactttccgttaccggaaggaatgaacctgcccctgaccctgcgccattaccgggtg
ttcatctcatactgcgcgccctccagaaaaaaaagccgggccgatatcctggagatggaa
aacctggtgaagattatccgggcttccctgcagggggcatacatcagcacacagaccgtt
gatgcgaaggcatttattaatattgtcggggagatgattaatcacaatccggaatccatc
catccgacccggcgccggctggacccgtattccgacctgaattaccagtgcgtggacgac
tcctttgacctgaaggtcaggcaggattacctgacgctgggactgcgcgataacgggaaa
aacagcaccgcgcgcatcatgagttttcatctggcccgtaacccggaaatcgccttcctg
tggaactcggcggataattacagcaatctgctgaacccggagctgtccatctcctgtccg
ttcattctgacgctgaccctggtggtggaagaccaggtgaagacccacagcgaagcgaac
ctgaagtacatggatctggagaagaagtcgaagacctcctacgccaaatggttcccgtcc
gtggagaaggaagcgaaggagtggggagacctgcgccagcgcctggcgtcgaaccagtcc
tcggtggtgtcctactttttcaatatcacggcgttctgccgcgacaacaaggaaacggcg
ctggaaacggagcaggatatcctgaacagtttccgtaaaaacggttttgagctgatttcg
ccgcgctttaaccacatgcgtaatttcctggcctgcctgccctttatggccgggaaggga
ctgtttaagcagctgaaggaagccggtgtggtgcagcgggcggagagcttcaatgtgacc
aacctgatgcccctggtggcggataacccgctgacgcccgccgggctgctggctccgacc
taccgtaaccagctggcctttattgatattttcttccggggaatgaacaacaccaactac
aacatggcggtctgcggaacttccggggcgggcaagaccgggctgatacagccgcttatc
cgcagcgtgctggattccggcggctttgcagtggtgtttgacatgggggacgggtacaag
tccctgtgcgaaaatatgggcggggtgtacctggacggggagaccctgcgttttaacccc
ttcgccaatatcaccaatattgaccagtcggccgaacgtatccgcgaccagttgtcggtg
atggccagccccaacggcaaccttgacgaagtccatgagggcctgttgctgcaggcggtc
agggcagcctggctgacaaaaaagaaccgggcgcgtattgatgacgtggtggattttctg
gaaaacgcccgcacgagcgaacagtatgcggagtcacccggtatccgcagccgcctggat
gaaatgattgtcctgctgaaccagtacacggcagcaggcacttacggcagatacttcaac
tccgatgaaccctccctgcgcgatgatgccaggatggtggtgctggagctgggtggcctg
gaagaccgcccgtccctgctggttgcggtgatgttttccctgattatctacatcgaaaac
cggatgtaccgcacgccgcgtaacctcaaaaagctgaacgtgatcgacgaaggctggcgt
ctgctggacttcaaaaaccgcaaggtcggggacttcatcgaaaaaggctaccgtactgcc
cgccgtcacaccggcgcgtatatcaccatcacgcagaatatcgtcgactttgactccgac
aaggcgtccagcgccgcccgcgcggcatggggtaactcttcctacaaaattatcctcaaa
cagagcgccaaagaattcgcgaaatacaaccagctgtatccggatcagttcccgcagcta
caccgggagatgattgagaaatttggcgccgcgaaagaccagtggttcagctcgttcctg
ctgcaggtggaaaaccattcctcctggcaccgtctgtttgtcgacccgctcagccgcgcc
atgtacagctcggacggtcctgattttgagtttgtacagcagaagcggaaagaggggctg
agtattcacgaggcggtctggcagctggcgtggaaaaagtcaggaccggagatggcctcg
ctggaggcctggctgcaggagcatgagacattcaggggaacttatgagtacaaagcagaa
acagactga

DBGET integrated database retrieval system