KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT094
Entry
PSLT094           CDS       T00065                                 
Symbol
trbC
Name
(RefSeq) conjugative transfer: assembly
  KO
K12059  conjugal transfer pilus assembly protein TrbC
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT094 (trbC)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT094 (trbC)
SSDB
Motif
Pfam: TrbC_Ftype
Other DBs
NCBI-GeneID: 1256145
NCBI-ProteinID: NP_490578
UniProt: Q93GM8
Position
pSLT:73526..74164
AA seq 212 aa
MHRKIKYLAGLIMVISGTVSAGGVANTPENRQFLKQQEELSRQLRDRPDAELKAWADRQI
QANPLVQSDRHFLDDLARKQQTSQADKPEQGAVYFISFSIPEEGLKRMLGETRRYGIPAT
LRGMRDNDLKATADAVLSLVKDGATDGVQIDPTLFTKYDIRSVPTLVVYCRQGYDVIRGN
LRVKQALEKVVTAGDCRQVAAGLLDGAGDKPQ
NT seq 639 nt   +upstreamnt  +downstreamnt
atgcacaggaaaataaaatacctggccggactgattatggtcataagcgggacggtatca
gccggcggagtcgctaatacccctgaaaaccgccagttcctgaagcagcaggaggaactg
agccggcagttgcgcgaccggcctgatgctgaactgaaagcgtgggcagaccggcagatt
caagcgaatcccctggtgcagtcagaccggcatttcctggatgaccttgcccgaaagcag
cagacttctcaggcggataaaccggagcagggcgcggtgtactttatctcgttttccatt
ccggaagaggggctgaagcgcatgctgggcgaaacccgtcgctacggtattccggccacg
ctgcggggaatgcgggataacgacctgaaagccacggcagatgccgttctgtccctggta
aaggatggggcaacagatggtgtgcagattgacccgacgctgttcacgaaatatgacatc
cgcagcgtaccgactctggtggtgtactgccgacagggatatgacgttatccggggcaat
ctgcgggtgaagcaggcgctggagaaagtggtcaccgccggggactgcaggcaggtggct
gccggattacttgatggtgccggagataaaccgcaatga

DBGET integrated database retrieval system