KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT095
Entry
PSLT095           CDS       T00065                                 
Symbol
traN
Name
(RefSeq) conjugative transfer: aggregate stability
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT095 (traN)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT095 (traN)
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-GeneID: 1256144
NCBI-ProteinID: NP_490579
UniProt: Q93GM7
Position
pSLT:74617..76443
AA seq 608 aa
MKRMLPLFLLLAAGQAQADSNSDYRAGSDFAHQIKGQGTGSIRNFNPQESIPGYNANPDE
TKYYGGVTAGGDSGLKNDGTTQWATGETGKTITESFMNKPKDILSPDAPFIEKGRDVVNR
ADSIVGNTGQQCSAQEINRSEFTNYTCERDTTVEEYCTRTATITGDWRETTEVRTYTLTA
FSFSRSGKQIVFSVTVPEAGTISSASLNVITQNYLWNSRAGFMNTIFNMTWGSTITLGGA
TGMMLSKGQILSGTSCSGNGSCTGTLDDRIFNELTSGRTTFTLTLVMQVKDREWIPRVEW
VESCPFNKADGVLKGTECSEPGGTKTGVMEGKPWSLTEACWAYRDKYVTQSADNGTCQAY
VDNPACTLATRQCAFYSGEGTCLHEYATYSCESKTSGKVMICGGDVFCLDGECDKAQSGK
SNDFGEAVSQLAALAAAGKDVAALNGIDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIG
LAKCSSDEKALAKAKTNKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNG
QLHISFGSSKHPDCRGITVDELQQIKFDQLDLTNFYEDLMNNQKIPDSGALTEKVKEQIA
DQLRQAGK
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgaaacgtatgttacctctgtttctgcttctggcagccggccaggcacaggctgacagt
aacagtgattatcgtgcgggttcagattttgcccatcagatcaaaggccagggcaccggc
agtatccggaattttaatccgcaggagagtatacccggctataacgcgaatccggatgaa
acgaaatattacggtggcgtgaccgccggtggtgacagtgggctgaagaatgacggcacg
acgcagtgggccacaggcgaaaccggtaaaaccattacagaatcgttcatgaacaagccc
aaagatattctgtcaccggatgcgccgtttattgaaaaaggaagggatgtggtgaaccgt
gccgacagtattgtgggaaataccgggcagcagtgcagcgcgcaggagattaaccgcagc
gaattcacgaattatacctgtgaacgcgacaccactgtggaggaatactgtacccggacg
gccaccatcaccggcgactggagagagacaacagaggtcagaacctacaccctcaccgcc
tttagtttcagccgttccggtaagcagatcgttttcagcgtaaccgtgccggaagcgggt
acgataagcagcgccagcctgaatgtgatcacacagaattatctgtggaattcccgtgcc
ggctttatgaataccatcttcaacatgacgtggggcagtaccattacactgggtggcgcg
acgggaatgatgctgagtaagggccagattctgagcgggacaagctgcagcgggaacggt
agctgtaccgggacgctggatgaccgcatttttaacgaactgaccagcgggagaacgacg
ttcacgctgacactggtgatgcaggtaaaggaccgggagtggataccccgggtggagtgg
gtggaaagctgcccgtttaataaagcggatggcgtgctgaaaggcacagaatgctcagag
ccaggtggtacgaaaaccggggtgatggaaggaaaaccctggagcctgacggaggcctgc
tgggcataccgcgataaatatgtcacccagtctgcggacaatggcacctgccaggcgtat
gtggacaatccggcctgtactcttgccacccggcagtgcgcgttttattccggtgagggc
acctgcctgcatgagtacgccacgtactcctgtgagtcgaaaacgtcaggaaaggtcatg
atttgtggcggggatgtgttctgcctcgatggggaatgcgataaggcgcagagcggaaag
agcaatgattttggcgaggcggtatcgcaactggcggcgctggcggcggcaggtaaagat
gtcgcggccctgaacggtattgacgtccgtgcattcaccggacaggcgaaattctgtaag
aaggccgcagccgggtacagcaactgctgtaaggacagtggctgggggcaggatatcggt
ctggctaaatgcagtagtgacgaaaaagctctggccaaagcaaaaacgaacaaactgacg
gtcagtgtcggggaattctgttcgaaaaaggtactgggtgtctgtctggagaagaaacgc
agctactgccagtttgattcgaagctggcgcagatagtccagcagcaggggcgcaacggc
caactgcatatcagcttcggcagttcaaaacatcctgactgccggggtatcaccgtggac
gaactgcagcagattaaattcgaccagctggacctcacgaacttctacgaagacctgatg
aataaccagaaaatcccggacagtggcgcgctgacggagaaggtgaaagaacaaattgca
gaccaactcaggcaggccgggaaataa

DBGET integrated database retrieval system