KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT097
Entry
PSLT097           CDS       T00065                                 
Symbol
traF
Name
(RefSeq) conjugative transfer: assembly
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT097 (traF)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT097 (traF)
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-GeneID: 1256140
NCBI-ProteinID: NP_490581
UniProt: Q93GM5
Position
pSLT:76681..77430
AA seq 249 aa
MRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKSAQVRQEPDIMQKLSAL
QTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFSMSAKKAMLAHPELDYNLQYSHY
NGTVRNQLAADQAQQRQAISKLAEHYGIMFFYRGQDPIDGQLAQVINGFRATYGLSVIPV
TVDGVINPMLPDTRPDQGQAQRLGVKYFPAMMLVDPKQGSVRPLSYGFITQDDLAKQFLN
VSEDFKPNF
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcgaaaaatacagaccgtatgggtggcagcgttactctgtggctccctgacggcatac
ggaaaagatgccggatggcagtggtataacgacccggtaaaattacctgacccaaaaacg
acggataaatccgctcaggttcgtcaggagcctgacattatgcagaaattatctgcgctg
cagaccgcaacaaagcgggcgctttatgaagccattctgtatcccggtgtggataatttt
gtgaaatatttccggctgcagaattactggacgcagcaggcggggcttttcagcatgagc
gccaaaaaagccatgctggcgcatcctgaactggactataacctgcagtacagccactac
aacggcacggtacgtaaccagctggccgcagaccaggctcagcaacggcaggccatatca
aagctggctgaacactacggtatcatgttcttttaccgcgggcaggaccccattgacggc
cagctggcgcaggtgattaatggctttcgcgccacttacggtctgagcgttatcccggtg
accgtggacggggtgattaacccgatgctgccggatacgcgtcctgaccaggggcaggcg
cagcgtcttggtgtgaaatatttcccggccatgatgctggtagacccgaaacagggcagt
gtccgtccgttgtcatacgggtttattacgcaggacgacctggcaaaacagttcctgaat
gtgtcagaagattttaagccgaatttctaa

DBGET integrated database retrieval system