KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT098
Entry
PSLT098           CDS       T00065                                 
Symbol
traQ
Name
(RefSeq) conjugative transfer: fimbrial synthesis
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: TraQ
Other DBs
NCBI-GeneID: 1256141
NCBI-ProteinID: NP_490582
UniProt: Q93GM4
Position
pSLT:77644..77937
AA seq 97 aa
MRKYKLSLPLPDITGVWVFSLGVWFHIVGRLVYRKPWMAFFLAELIAIILVLSGAYRVLD
AWIARVSREERALLEARQAAILAAEKEEKGDKSHVSQ
NT seq 294 nt   +upstreamnt  +downstreamnt
gtgcgtaaatataaattatcgcttcctttaccggatattactggagtatgggttttctcc
ctgggcgtctggtttcacattgtcgggcggctggtttaccgcaaaccctggatggctttt
tttctggcggaactgattgccatcattctggtgttgtccggcgcttaccgggtgctggat
gcctggatagcccgcgtcagccgggaagagcgtgcgttactggaagcccgtcaggctgcc
attctggctgctgaaaaagaagaaaagggggataaatcacatgtctctcaataa

DBGET integrated database retrieval system