KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT100
Entry
PSLT100           CDS       T00065                                 
Symbol
traH
Name
(RefSeq) conjugative transfer: assembly
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT100 (traH)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT100 (traH)
SSDB
Motif
Pfam: TraH DUF5667 DUF5443 DUF1722
Other DBs
NCBI-GeneID: 1256138
NCBI-ProteinID: NP_490584
UniProt: Q93GM2
Position
pSLT:78462..79844
AA seq 460 aa
MQGKTRIKPLFILCTALMTVAPAVSADVNSDMNQFFNKLGFASNTTQPSVWQGQAAGYAS
GGSLYARTQVKNVQLVSMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYF
FDLALQTTVPEIKTAKDFLQKMASDINSMNLSSCQAAQGIVGGLFPKTQVSQQKVCQDIA
GESNIFADWAASRQGCTVGGQSDSVRDKASDKDKERVTKNINIMWNALSKNRMFDGNKEL
KEFVMTLTGSLVFGPNGEIMPLPARTTDRAIIRALMEGGTAKIYHCNDSDKCLKVVADTP
VTISRDNALKSQITKLLTSIQNKAVSDTPLDNKEKGFISSTTIPVFKYLVDPQMLGVSTS
MIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHITDNMNDATRQIASFQAQV
QVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGGAQ
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcagggtaaaacgagaattaaaccgcttttcatattatgtacggcgctgatgaccgtc
gcacccgccgtctctgccgatgtgaacagcgacatgaaccagttcttcaataagctgggc
tttgcttccaataccacacagccctccgtctggcagggacaggcggcaggatatgcctcc
ggcggctctttatatgcccggacacaggtaaaaaatgtccagctggtctccatgaccctg
ccggatatcaatgccggttgcgggggcatcgatgcctatctcggctcattcagtttcatt
aacggcgagcagctgcagcgttttgtgaagcagattatgagtaacgccgcagggtacttt
tttgaccttgcgctgcagacgacggtgccggaaatcaaaacggcaaaggattttctgcag
aaaatggcctccgacattaacagtatgaacctcagctcctgccaggcggcgcaggggatt
gtcggggggcttttcccaaaaacacaggtctcccagcagaaggtctgccaggacattgcc
ggtgagagcaatatttttgccgactgggcggcgtcccggcagggatgtactgtgggcggg
caatccgacagcgtcagggataaagccagtgacaaggataaggagcgggtgaccaaaaat
atcaacatcatgtggaatgctttgtccaaaaacaggatgtttgacggcaacaaggagctg
aaagagttcgtgatgacgctgaccggttcactggtttttggacccaacggcgaaatcatg
cccctgcctgccagaaccaccgaccgggctattatccgggcattaatggaaggcggaacg
gcgaagatataccactgcaatgattcggataaatgcctgaaggtggtggccgacacgccg
gtgaccatcagtcgcgacaatgcgctcaaatcacagattacgaagctgctgaccagtatt
cagaacaaggcggtcagcgacactcccctggataataaggaaaaagggtttatctccagc
accaccatcccggttttcaaatacctggttgacccgcagatgctcggcgtgtcaaccagc
atgatttatcagctgacggattatatcgggtacgacatcctgctgcagtatatccaggag
ctgatccagcaggcccgggcgatggtggccacagggaattatgacgaggcggttatcgaa
catatcaccgacaacatgaatgacgcgacccggcagatagcgtccttccaggcgcaggtc
caggtgcagcaggatgcgctgctggttgtcgaccgtcagatgagctacatgcgccagcag
ctgtcagcccgcatgctcagccgttaccagaacaactatcattttggcggaggtgcgcag
tga

DBGET integrated database retrieval system