KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT101
Entry
PSLT101           CDS       T00065                                 
Symbol
traG
Name
(RefSeq) conjugative transfer: assembly abd aggregate stability
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    PSLT101 (traG)
Secretion system [BR:stm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSLT101 (traG)
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-GeneID: 1256136
NCBI-ProteinID: NP_490585
UniProt: Q93GM1
Position
pSLT:79841..82663
AA seq 940 aa
MNEVYVIAGGEWLSNNLNAIAAFMSTRTWDSIEKIALTLSVLAVSVMWVQRHNVMDLLGW
VAVFVLISLLVTIRTSVQIIDNSDLVRVYRVDNVPVGLALPLSLTTRIGHAMVASYEMIF
AQPDSVTYSKTGMLFGANLIVKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYSLEEL
MESDDPYTLIFSRPSPLRGVYDKNNHFVTCKDASVTLKDKLNLDTKTGGKTWHYYVQQIF
GGRPDPDLLFRELVSDSYSYFYGSSQSASQIMRKNVTMNALKEGITSNAARNGDTASLVN
LATTSSMEKQRLSHVSIGYVTMRNLPMVQTILLGIAIGIFPLLVLAAVFNKLTLSVLKGY
VFALMWLQTWPLLYAILNSAMVFYAKQNGAPVVLSELSQIQLKYSDLASTAGYLSAMIPP
LSWMMVKGLGAGFSSVYSHFASSSISPTASAAAGVVDGNYSYGNMQTENVNGFSWSTNST
TSFGQMTYQTGSGATATQTRDGNMVMDASGAQSRLPVNINATRQIAAAQQEMAREASTQA
ESALHGFSSSIASAWNTLSQFGTNRGSSDSVTSGADSTMSAQDSIMASRMRSAVESYAKA
HNISNEQATQELAARSTRTSGGIYGDASAEWGIRPKILGVGGGAGVKAGGRAGIDWSDDD
THQASSSSRSSQDVRHGVDAKATQDFKEASDYFTSRKVSESGSHTDNNADSRVDHLSAAL
NSAKQSYDQYTTNLTRSHEYAEMASRTESMSGQMSEDLSQQFVNFVQKHAPQDAENILTN
TSSPEVAERRRAMAWAFVQEQVQPGVDNAWGEARGDIGSGMSTVSGGGDKQDVVADHQAH
QATVEQRTRDSNISNDVKNQVDNMVTDYHSDINDTYGNIQGEEKTIDQQYSGLQKQYKTE
ALSQNNKYNEEKAAQERMPGADSPEELMKRAKEYQDKHKQ
NT seq 2823 nt   +upstreamnt  +downstreamnt
gtgaacgaagtctatgtcattgccggcggagaatggctgagtaataacctgaacgccatt
gcggccttcatgagcacccggacgtgggactccattgagaaaattgcgctgaccctgtcc
gttctcgcggtgtccgttatgtgggtacagcgacataacgtgatggatctgctgggctgg
gtggcggtgtttgtgctgatatcacttctggtgaccatacggacatcagtacagataatt
gataacagcgacctggtgagggtttaccgggtggataatgtgccggtcggactggcactc
cccctttcgctgacgacccggatcgggcatgcgatggtggccagctatgagatgattttt
gcccagccggacagcgtcacctacagcaagacaggtatgctgttcggggcgaatctgatt
gtgaaaagcaccgatttcctgtcccggaatccggaaatcattaacctgtttcaggactac
gtccagaactgtgtgctgggggatatttacctcaatcacaaatattccctggaagaactg
atggaatccgatgacccctatacgctgattttttcccgcccaagtccgttgcggggggtt
tatgacaaaaataatcattttgtcacctgcaaggatgcgtcggtcacgctgaaagacaag
ctgaatctcgatacaaagacaggaggcaagacctggcattattatgtgcagcagatattt
gggggcaggccggaccctgacctgttattcagggaactggtaagtgacagttacagttat
ttctatggctccagccagtcagccagccagatcatgcgtaagaatgtaacaatgaacgct
ctgaaagaagggatcaccagtaatgcagcccgtaacggtgataccgccagtctggtgaat
ctggccaccacatcctcgatggaaaaacaacgtttgtcacatgtctccattggttatgtg
acaatgcgaaacctgccgatggtacagactattctgctggggatagccatcgggattttc
ccgttactggttctggccgctgtctttaataaactgacgctgtcagtgctgaaagggtat
gtatttgccctgatgtggctgcagacatggccgttgctgtatgccattctgaacagcgcc
atggtgttctatgcgaaacagaatggtgccccggtggtgctgtcagaactctctcagata
cagctgaaatattccgatctggcatcaaccgcaggttatctctctgccatgattcccccg
ctgtcgtggatgatggtaaaaggtctgggcgctggattttccagcgtttacagccacttt
gcgtcttcgtctatcagcccgacggccagtgcggctgccggcgtggtggacggcaattat
tcctacggcaacatgcagacggagaacgtcaacggcttcagctggagtaccaacagtacc
acgtcatttggccagatgacttaccagaccggtagtggggcgaccgccacgcagacccgg
gacggcaatatggtcatggatgccagcggtgcgcagtccagactgccggtgaatatcaac
gcgacccggcagatagcggcggcacagcaggagatggcgcgggaagccagcacgcaggca
gaaagcgccctgcatggtttcagcagcagtatcgccagcgcctggaatacgctcagccag
ttcgggacgaaccggggcagcagcgactcagtgaccagtggtgctgacagcaccatgagc
gcgcaggattccataatggccagccggatgcgcagcgcagtggaaagctatgcgaaggca
cataatatcagtaatgagcaggccactcaggaacttgcagcgagaagtacgcgaacatct
gggggtatttatggtgatgcaagtgcagagtggggcataaggcccaagatattgggggtc
ggtggtggagctggtgttaaagccggtggtcgtgctggtattgattggagcgatgatgat
acgcatcaggccagcagtagttcacgatccagccaggatgttcgtcatggtgttgatgcc
aaagccacgcaggattttaaggaggccagcgattacttcacgagccgtaaggtcagtgag
tccggaagccatacggacaataatgctgattctcgtgtggatcatttgtctgccgccctg
aactcagcgaaacagagttatgaccagtacaccacgaacctgacccgcagccatgagtat
gctgagatggcgtcccgtacagaaagcatgagtgggcagatgagcgaagatttgtcacag
cagtttgtgaattttgtgcaaaagcatgcgccacaggatgcagaaaatattctgacaaat
accagctcgccggaggtggcagaacgacgtcgggcaatggcttgggcctttgttcaggag
caggtacagcctggtgtggataatgcctggggcgaagcccgcggtgatattggcagtggt
atgagcacagtatccggtggtggtgataaacaggatgtggtagccgatcatcaggcccat
caggcaacggtggaacaacggacgcgggacagtaatatcagtaatgatgtaaaaaaccag
gttgataatatggtcacagactatcattccgatataaacgatacttatggaaatatccag
ggtgaggaaaagactattgaccagcagtattctggcctgcaaaaacagtataaaacagaa
gcactatctcagaataataaatataatgaagaaaaggctgcacaggaaaggatgcctggc
gcggatagtcctgaagaactgatgaagagggcaaaagagtatcaggataagcacaaacag
taa

DBGET integrated database retrieval system