KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT104
Entry
PSLT104           CDS       T00065                                 
Symbol
traD
Name
(RefSeq) conjugative transfer: DNA transport
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: TrwB_AAD_bind TraD_N TraG-D_C T4SS-DNA_transf Amelogenin AAA_16 TFIIA DUF2076
Other DBs
NCBI-GeneID: 1256134
NCBI-ProteinID: NP_490588
UniProt: Q93GL8
Position
pSLT:84317..86560
AA seq 747 aa
MSFNAKDMTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLVLWVKLSWQTFVNGGIY
WWCTTLEGMRDLIKSQPVYEIRYYGQTFRMNAAQVLQDKYTVWCGEQLWSAFVLAACVAL
VICLITFFMTTWILGRQGKQQSEDDVTGGRQLTDNPKDVARMLKKDGKASDILIGDLPII
KDSEIQNFLLHGTVSTGKSEIIRRLANYARQRGDMVVMYDRSCEFVKSYYDPSIDKILNP
CDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDSDRS
YSKLVDTLLSIKIEKLRTYLRDSPAANLVEEKIEKTAISIRAVLTNYVKAVRYLQGIERN
GEPFTIRDWMRGVREDQKNGWLFISSNADTHSSLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEIVPEARKFGGCYVFGIQSSTQMEDIYGEKAAATLLDVMNTRA
FFRSPSYKIADYVAHEIGEKEILKASEQYSYGADPVRDGVSTGKEMERVTLVSYSDIQSL
PDLTCYVTLPGPYPAVKLALKYQERPKVAPEFIPREMNPEAEARLSAVLAAREAEVRQMS
SLFEPDTEAVAPTAAEAQAEQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQPTVVSDK
KSAAAGTAVNTPAGGVGQELKMKPEDEEQPLPPGINASGEVVDMAAYERWRQEQEVNTQQ
QMQRREEVNINVHRGHGKDEPEPGDDF
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgagctttaatgcgaaggatatgacccagggcggtcagattgcgtccatgcgtattcgc
atgttcagtcagatcgccaacattatattttactgcctgtttattttcttctggatactc
gtcggcctagtgttatgggtgaaactcagctggcagacgtttgtgaatgggggtatctac
tggtggtgtaccacgcttgaaggaatgcgggatttaattaaatcccagcctgtctatgag
atccggtattacggccagacgttccggatgaacgccgctcaggttctgcaggacaaatac
acggtctggtgtggggagcaactgtggtcggcctttgttctggccgcctgtgtggcgctg
gttatctgcctgattacattttttatgaccacatggattctgggacgtcagggaaaacag
cagagtgaggatgatgttaccggaggacgccaacttaccgacaatccgaaagacgttgcc
agaatgctgaaaaaagacggaaaagcgtccgatatcctgattggcgatttgccaatcatt
aaggattcagagattcagaactttttgctccacgggacagtcagtaccggtaagtctgaa
atcattcgccggctggctaactatgcccgtcagcgcggcgacatggtggtgatgtacgat
cgttcctgtgagtttgtcaaaagctactacgacccgtccatcgataaaattctcaacccc
tgtgacgcgcggtgtgccgcatgggatttatggcgggaatgcctcaccctgccggatttt
gataatgcggcgaataccctgatcccgatgggcacgaaggaagatccgttctggcagggt
tccggacggaccatttttgctgaagcggcatacctgatgcgtaatgacagcgaccgcagc
tacagtaagctggttgacacgctgctttcaatcaagattgaaaaactgcgaacctacctg
cgtgattccccggcggccaacctggtggaagaaaaaatcgagaagacggccatttccatc
cgggctgtgctgaccaactacgtaaaagccgtccgctatcttcaggggatcgagcgtaac
ggtgaaccgttcaccatccgtgactggatgcgtggtgtacgtgaagatcagaagaatggc
tggctgtttatttcttcaaacgctgacacacattcttccctgaagccggtgatttccatg
tggctgtccattgccatccggggcctgctggcgatgggagagaaccgtaaccgtcgggtg
tggttcttctgtgatgagttgcccacgctgcacaagctgcccgacctcgtggaaattgtc
ccggaagcccgtaaattcgggggctgctatgtctttggtattcagtccagtacacagatg
gaggatatctatggcgagaaagcggcggcaaccctgctggatgtgatgaacacaagggcc
tttttccgctcacccagctataagattgccgactatgtcgcccatgagattggtgaaaaa
gagatcctgaaagccagtgagcagtattcctatggtgccgatcccgttcgtgacggggtg
tcgaccggtaaagagatggagcgtgtcacactggtcagctactccgatattcagtcactg
cccgacctgacctgttatgtcacgctgcccggaccctatccggcagtgaagctggccctg
aaataccaggaacgtcccaaagtggcgccggagtttattccccgggaaatgaatccggag
gcggaagcccgtctgagcgccgttctggctgcaagggaagccgaggtacgtcagatgtcc
agcctgtttgaaccggatacagaagcggttgcgccgacagcagcagaagcgcaggctgaa
cagccgcaacagccgcaacagccgcaacagccgcaacagccgcaacagccgcaacagccg
caacagccgcaacagccgcaacagccgcaacagccacagcccacggttgtcagcgataaa
aaatcagcagcggcgggtaccgccgtgaatacgcctgcaggcggtgtcggacaggaactg
aaaatgaagccggaagacgaagagcagccactgccccccgggattaatgcgtccggtgag
gtggtggacatggcggcgtatgagcgctggcggcaggagcaggaggtgaatactcagcag
cagatgcaacggcgggaggaggtgaatatcaacgttcaccgtgggcacggaaaggatgaa
ccggagccgggagatgatttctga

DBGET integrated database retrieval system