KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT108
Entry
PSLT108           CDS       T00065                                 

Gene name
traI
Definition
(RefSeq) conjugative transfer: oriT nicking-unwinding
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: TrwC TraI TraI_2B AAA_30 ssDNA_TraI_N AAA_19 AAA_11
Other DBs
NCBI-GeneID: 1256130
NCBI-ProteinID: NP_490592
UniProt: Q93GL4
Position
pSLT:87276..92534
AA seq 1752 aa
MMSIAQVRSAGSAAGYYSDRDNYYVLGSMEERWAGKGAEQLGLQGTVDKEVFTRVLEGRL
PDGADLSRQQDGGNKHRPGYDLTFSAPKSVSLMAMLAGDKRLTEAHNQAVDIAVRQVEAL
ASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHAVVVNVTQHDGEWKTLSSDKV
GKTGFIENVYANQIAFGKIYRAVLKEKVEALGYETEVVGKHGMWEMPGVPVEAFSSRSQA
IREAVGEDASLKSRDVAALDTRKSKQHVDPEVKMAEWMQTLKDTGFDISAYRESADRRAE
IQAAQPVPSQEQPDIQQAVTQAIAGLSDRKVQFTYTDVLARTVGMLPPEAGVIEKARAGI
DEAISREQLIPLDREKGLFTSGIHVLDELSVRALSSDIMKQNRVTVHPEKSVPRTGSYSD
AVSVLAQDRPSLAIISGQGGAAGQRERVAELTMMAREQGREVQIIVADRRSQTNLKQDER
LSGELITGRRQLQEGMLFSPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRT
GTGSALMAMKEAGVNSYRWQGRQQTPATVISEPDRNVRYARLAGDFVAAVKAGEESVAQV
SGMREQAILAGMIRSELKTQGILGQQDTMMTALSPVWLDSRNRYLRDMYREGMVMEQWNP
EKRSHDRYVIDRVTAQSHSLTLRDAQGETQMVRISALDSSWSLFRPEKMPVADGERLMVT
GKIPGLRVSVGDRLQVSAVNDGVMTVTVPGRAEPASLPVGDSPFTALKLENGWVETPGHS
VSDSAKVFASVTQMAMDNATLNSLARSGRDVRLYSSLDETRTAEKLSRHPSFTVVSEQIK
ARAGEVSLETAISRQKAGLHTPAQQAIHLALPVVESKNLAFSQVDLLTEAKSFAAEGTGF
ADLGREIDAQIKRGDLLYVDVAKGYGTDLLISRASYDAEKSILHHILEGKEAVTPLMERV
PGELMETLTSGQRAATRMILETKDRFTVVQGYAGVGKTTQFRAVMSAVNLLPESERPRVV
GLGPTHRAVGEMRSAGVEAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMA
RAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIVRQTPELRDAVY
SLINRDVNKALSGLENVKPVQVPRLKGAWAPENSVTEFSRLQERELAKAAQEAEKKGEAF
PDVPVTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIQDALAKPGEQQVTVPVL
TTANIRDGELRRLSTWEAHPGALALVDNVYHRIAGISKEDGLITLEDKAGNTRLISPREA
AAEGVTLYNPETIRVGAGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGKQTRVVR
PGQDRAEQHIDLAYAITAHSAQGASETFAIALEGTEGGRKQMAGFESAYVALSRMKQHVQ
VYTDDRQGWVKAINSAEQKGTAHDVLEPKSEREMMNAERLFSTARELRDVAAGRAVLRNA
GLAQGDSRARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGAGLRGFTGEGRVK
GSEEAQFVALQGSRNGESLLAGSMQDGVRIARENPDSGVVVRIVGDGRPWNPVAITGGRV
WGDIPDSNVQPGAGNGEPVTAEILAQRQAEEAVRRETERRADEIVRKMAEDKSDLPEEKT
AQAVREIAGQEQDRMTPPEREPPLPESVLREPQRERETIREVARENRGRERLQQMEQEMV
RDLQKEKTPGGD
NT seq 5259 nt   +upstreamnt  +downstreamnt
atgatgagtattgcgcaggtccggtcggcgggaagtgccgccggttattacagcgacagg
gataactactacgtgctgggcagcatggaagagcgctgggccggaaaaggcgcggagcag
ctggggttgcagggcaccgtcgataaggaggtgttcacccgggtactggaaggcagactg
cccgacggggctgatctgagccggcagcaggatggcggcaacaaacaccgccccggctat
gatctgaccttctctgcccccaaaagtgtttccctgatggccatgctggccggtgataaa
cgcctgactgaggcacacaaccaggcggtggatatcgctgtccgtcaggtggaggcgctg
gcctccaccagggtgatgacggacggacagtcagaaacggtgctcaccggtaatctggtg
atggcgctgttcaatcatgacaccagtcgtgaccaggagccgcagttgcatacccatgct
gtggtggtcaacgtcacgcagcatgacggggaatggaagaccctgagcagcgataaggtg
ggcaaaacgggatttatcgagaatgtctatgctaaccagatagccttcgggaagatttac
cgcgcggtgctgaaagagaaggttgaagcgctgggctatgaaacggaagtggtcggtaag
cacggtatgtgggagatgcccggtgtcccggtggaggccttttccagccgttcgcaggcc
atccgagaggcggtcggggaggatgcctcgctgaaatcccgggatgtggcggcgctggat
acgcgtaaatccaaacagcatgtcgatccggaagtgaaaatggctgagtggatgcagacc
ctgaaagataccgggtttgatatcagcgcataccgtgagtctgcggacaggcgggcggaa
atacaggcagcacagcctgttccgtcacaggagcagccggatattcagcaggcggtgacg
caggccattgccggattaagcgaccggaaggttcagtttacgtataccgacgtgctggcc
agaacggtcggcatgctgccgccggaagccggcgtgattgagaaagcccgggccgggatt
gatgaggccatcagccgcgagcagcttatccccctcgaccgggagaaaggactgttcacc
tccggtattcatgtgctcgatgagctgtctgtccgggcactcagcagcgatatcatgaag
cagaaccgggtgaccgtccatccggagaagagcgtgccccgcacgggaagttacagcgac
gcggtgagtgtcctggctcaggaccgcccgtcactggccattatcagtggtcagggcggt
gctgccggtcagcgggagcgggtggcggaactgacgatgatggcccgggagcaggggcgt
gaggtgcagattattgtcgctgaccgccgttcgcagacaaacctgaagcaggatgaacgt
ctgtccggtgagctgataaccgggcgtcgtcagttgcaggagggcatgttattttccccg
ggcagtaccgttattgtcgaccagggggaaaagctgtccctgaaggagactctgaccctg
ctggatggcgcggcgcgtcataacgtccaggtgctaattaccgacagcggtcagcgcacc
ggtaccggcagcgcgctgatggccatgaaggaggccggcgtgaacagttaccgctggcag
ggcaggcagcagaccccggcgaccgttatcagcgagccggaccggaatgtccgctatgcc
cggctggccggggattttgtggctgcggtgaaagccggggaagagagcgtggcacaggtc
agcggcatgcgtgaacaggccatactggcggggatgatacgcagtgagctgaagacgcag
gggatactcgggcagcaggacaccatgatgaccgccctgtcaccggtctggctggacagc
cggaaccgttacctgcgcgatatgtaccgtgaagggatggtgatggagcagtggaacccg
gagaaacggtcccatgaccggtatgtgattgaccgggtgaccgcacaaagtcacagtctg
accctgcgggatgcgcagggagagacgcagatggtgcggatttcagccctggacagcagt
tggtcactcttccgaccggagaagatgccggtggcagacggtgagcgtcttatggtgacg
ggaaaaattcccgggcttcgcgtctccgtcggcgaccggctgcaggtatctgcggtgaac
gatggcgtgatgacggtgacggtacccggcagggctgaaccggcttccctgccggtgggg
gattccccgttcacggcgctgaagctggaaaacggctgggtggaaacacccgggcattcc
gtcagtgacagtgcgaaagtttttgcttccgtcacacagatggcgatggacaacgccacc
ctgaacagtctggcccgcagcggccgggatgtccggctgtattcctcactggatgagacc
cgcactgctgaaaaactctcccgtcacccgtcttttacggtcgtttctgagcagataaag
gcgcgtgccggtgaggtatcgctggaaaccgccatcagccgccagaaagccgggcttcac
acgccggcacagcaggccattcaccttgcccttccggtggtggaaagtaaaaacctggca
ttcagtcaggtggacctgctgacggaggcgaagtcgtttgctgcagagggaaccggtttt
gctgacctgggacgggaaattgatgcgcagataaaacggggcgatttactgtatgtggat
gtggcaaaaggttatggcacagacctgctgatttcccgtgcgtcgtatgacgctgaaaag
agtattctgcatcatatccttgagggcaaggaggcggtcacgccactgatggagagggta
cccggcgaactcatggagactctgacatccggacagcgtgccgccacccgtatgatactc
gaaacgaaagaccgtttcaccgtggtacagggttatgccggggtgggcaagaccacccag
ttccgggcggtgatgtcagcggtgaacctgctgccggagagtgagcgtccccgcgtcgtg
gggctgggaccgacccacagggcggtcggggagatgcgcagtgccggcgtggaagcacag
acgctggcgtcctttctgcacgacacgcaactgcagcagcgcagcggtgaaacgccggat
ttcagcaacacgctgttcctccttgatgagagttcgatggtgggcaacaccgatatggcg
cgggcatacgccctgattgcggccggtggtggtcgtgccgtggcgagcggtgacacggac
cagctgcaggccatcgcacccggccagcctttccgcctgcagcagacgcgcagcgcggct
gatgtggccatcatgaaggagattgtacgccagacaccggaactgcgggacgccgtgtac
agcctgattaaccgggatgtgaataaggcactgtccgggcttgaaaacgtgaagccggtt
caggttccccgcctgaagggggcatgggcgccggaaaactcggtgacggagttcagccgt
ctgcaggagcgggaactggcgaaagccgcacaggaggcggagaaaaagggcgaagccttt
ccggatgtgcccgtgacgctgtatgaggccattgtccgcgactataccggcagaacgccg
gaagcccgggagcagacgctgattgtcacgcatctgaatgaggaccgtcgggtgctgaac
agcatgattcaggatgcgctggcgaaaccgggtgagcagcaggtcactgtccctgtactg
accaccgcgaatatccgtgacggggaactgcgccgtctgtccacctgggaggcgcatccg
ggggcgctggccctggtggataatgtgtatcaccggattgccggtatcagtaaggaggac
gggctgattaccctggaagataaggcgggtaacacccgccttatttccccccgggaagca
gcggcagagggcgtcacactatacaatccggaaactatccgggtgggggccggtgaccgg
atgcgtttcacgaagagtgacagggaacgcgggtatgtggccaacagcgtctggacggtg
acggcggtttccggtgacagcgtcacgctgtcagacgggaaacagacccgcgtggtgcgt
cccgggcaggacagggcagagcaacatattgacctggcgtatgccatcaccgcccacagt
gcgcagggggccagtgagacgtttgccattgcgctggagggaaccgaagggggccggaaa
cagatggccggttttgagtcggcgtatgtggcgctgtcgcgtatgaagcagcatgtgcag
gtgtacaccgacgaccgtcagggttgggttaaggccatcaacagtgcggagcaaaagggc
acggcccatgacgtgctggagcctaaatcagagcgtgagatgatgaacgcagagcgcctg
ttcagcaccgcccgggaactgcgggacgtggccgccggccgtgccgtgctgcgcaacgcc
ggactggcgcagggagacagccgggcgcgttttattgcaccggggcgcaagtatccgcag
ccgtatgtggcgctgccggcgtttgaccgtaacggtaaatccgccggtatctggctgaac
ccgctgacaacggatgacggtgccgggctgcggggattcaccggggaaggtcgggtgaaa
ggcagtgaagaggcgcagtttgtggccctgcagggcagtcgtaacggcgaaagcctgctg
gctggtagcatgcaggatggcgtccggattgcccgggagaaccccgacagcggcgtggtg
gtgcgaattgtcggtgacgggcgtccatggaatcccgtcgccattaccggcggcagggtg
tggggcgatattcctgacagtaacgtgcagcccggcgcggggaacggggagccggtcacg
gcagagattctggcacagcggcaggcagaagaggcagtccgccgtgaaacagaacgccgt
gcggatgagattgtccgtaaaatggctgaggacaaatctgacctgccggaggagaaaacc
gcgcaggcggtcagggagattgccggccaggagcaggacagaatgaccccgcctgaacgg
gaacccccgctgccggagagtgtgctgcgcgaaccacaaagggagcgggagaccatccgg
gaagtggcgcgggaaaaccggggccgggagcggctgcagcagatggagcaggagatggtg
cgtgacctgcagaaagagaaaacccctggcggggactga

DBGET integrated database retrieval system