KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: PSLT110
Entry
PSLT110           CDS       T00065                                 
Symbol
traX
Name
(RefSeq) conjugative transfer: fimbrial acetylation
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB
Motif
Pfam: TraX
Other DBs
NCBI-GeneID: 1256128
NCBI-ProteinID: NP_490593
UniProt: Q93GL3
Position
pSLT:92554..93294
AA seq 246 aa
MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFL
AGRGAFPLFALVWGLNLSQHTHIRQSAINRLWGWAVIAQSGYFLAGFPWYEGNILFAFAV
TAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVLVLVICYRLYRTTDTEEHLAL
AACLVVAVPALNLVTSDAAAVAGLLVTGLTVWLVSLTGKSRPRFWPADFFPVFYTCHLAA
LGVLAM
NT seq 741 nt   +upstreamnt  +downstreamnt
atgacgatggataacgccacacgtaacgattcgcgggcagtccgggtggatacccggctg
cagcgactgctggcctggtcgccgggacagagagatctcatcaaaaccgtggcgctgctg
ctgatggtggctgaccatattaaccgtatcctgcacctgaaccaagagtggctgtttctg
gccgggcgcggggcgtttccgctgtttgccctggtgtgggggctgaacctgtcccagcat
acgcatatccgccagtctgcgattaaccggctgtggggatgggcggttatcgcgcagtcc
ggatattttctggcgggatttccgtggtatgaagggaatattctgtttgcctttgcggtg
accgcgcaggcgctgaagtggtgtgagcagcgctgcctgtttcactctgcggccgcgctg
ttactgctgacggcgtggatacccctgtccggaaccagctacggcgttgccggcgtgctg
gtgctggtcatctgttaccggctgtaccggaccacagatactgaagaacatctggcgctt
gcggcctgcctagtggtggccgtccccgcgctgaatctggtcaccagtgatgccgcggcg
gtggcaggacttctggtgaccgggctgacggtatggcttgtttcgctgacaggcaaatca
cggccccggttctggccggctgattttttcccggtattctacacctgccatctggctgcc
ctgggcgttctggcgatgtga

DBGET integrated database retrieval system