KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0276Help
Entry
STM0276           CDS       T00065                                 

Definition
(RefSeq) Hcp1 family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STM0276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    STM0276
Secretion system [BR:stm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-GeneID: 1251795
NCBI-ProteinID: NP_459274
UniProt: Q7CR58
Structure
PDB: 

Position
316894..317379
Genome map
AA seq 161 aa AA seqDB search
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgacatttttttgaaaattgacggcattgatggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcaccaacctggattttgatcac
tatatcgaccgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtggagctctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggcggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system