KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0279
Entry
STM0279           CDS       T00065                                 

Definition
(RefSeq) Hcp1 family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STM0279
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    STM0279
Secretion system [BR:stm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM0279
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 1251798
NCBI-ProteinID: NP_459277
UniProt: Q93IS3
Structure
PDB: 
5XEU

Position
318680..319165
AA seq 161 aa
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEH
YIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIA
SRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcttatgacatttttctgaaaattgacggcattgacggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggtctcggttccggtaaggtctccgtcactaatctttcatttgaacat
tacatcgatcgcgccagcccgaacctgttcaaatactgctcttccggtaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtacact
ttcacagatctgattattgcaatggtatcgcccagcggaagccagggaggggaaattgcg
tctcgcgaatcaattgaactctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggtggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system