KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0281Help
Entry
STM0281           CDS       T00065                                 

Definition
(RefSeq) type VI secretion system-associated protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    STM0281
Secretion system [BR:stm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE DALR_1
Motif
Other DBs
NCBI-GeneID: 1251800
NCBI-ProteinID: NP_459279
UniProt: Q93IS1
Position
319772..321115
Genome map
AA seq 447 aa AA seqDB search
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKL
ILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPES
LARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRI
DIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLTGSDNHGHEAAEVSDYLLL
QILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQTRRPAEYKEYKHLTPYAGL
KSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLAIKASMPTDVL
LQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaatgaccgcgtagtctggagtgaaggacaatttttactgccgcagatgttt
cagcagcaagagcgttatctggaacacgtcatgcattaccgcagcctgccgctgaccccc
tttttctggggattcagccactacaatattgatggcgaagcgctgaacatcggtaaactg
atactgaaagaggcatcagggatttttcctgacggcacgccgtttaacgcaccggaccac
accccgctgccgccgccactgaccattctgccggagcacctgaaccagcagatttgtctg
gcggtaccggtacgcgcgccgaacagcgaagaaaccacgtttgacaataacccggaatca
ttggcgcgtttctcggtacatgaacacgacatccgcgacgccaactcgctgggacgtggc
gcgcagttattacagctcagtcatctgcgcctgcggctgctgccggaaaaggcggtgacg
ggcgcctggattggcctgccgttgacccgcatcaccgggttgaaccctgacgggcggata
gatatcgaccacgacctgatcccgcccatcattaattatcaggccagttcactgatgtgt
acctggctgtcgtggatcaacgatctcatccggatgcgggccgattcgctggcggaacgg
ctgaccggcagcgacaaccacggccatgaagcagcggaggtctccgattacctgctgctg
caaattctcaatcgctttgagccgctgctgactcacctggcgaaaaccccgctggccccg
gaggtgctgtaccgctacctgtccgaactggccggggaactctccacctatgtgcgtcca
caaacgcgacggcccgctgaatacaaagagtacaaacacctgacgccctatgccgggttg
aaatcgctggttgatgaggtgcagttcctgctgaacgcggtactgatccggggcgcgcag
cgcatcgagctgaaagaggggacttacggcatcctgaatgcggtggtggccccttccgat
cttgccgatttcagcacgctggtactggcgataaaggcttcaatgccgaccgatgtgcta
ctgcaacattttgccgcccagaccaaaatcgggccatccgatcgcctgccggaactgatc
cgctcgcatctgccggggctggctttgcaggttctgcctgtaccaccgcgccaaatcccg
tttcaggccggatacatctattacgacatccgccgcgagggagcattgtgggaacacatt
gcccgttacggcgggatggccatgcataccgccggggaatttccggggctggagacagaa
ctgtggggagtgcgcgataaatga

DBGET integrated database retrieval system