KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0282
Entry
STM0282           CDS       T00065                                 

Definition
(RefSeq) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STM0282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stm02044]
    STM0282
Secretion system [BR:stm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM0282
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-GeneID: 1251801
NCBI-ProteinID: NP_459280
UniProt: Q93IS0
Position
321112..322416
AA seq 434 aa
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAA
ANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRY
CLCTALDEAANNTTWGRRGVWAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEV
IYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVMPALSPDFQGAISGRLRRM
RRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDAIGIKLPPPPVPVHKLRLKIL
LANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAAREIARVGGAVTV
TGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgacagacagtaccctgacgccgccagcggcggatatgatgtcctttttgtccaccacg
ccggaacataaggacagtgaatatgaaacgccggtacacaccagccagcgcacggaactc
aatgtcatcgttgaagacggtccggacagcaaactccggctggctgaaatcagcgcggcg
gctaacccgttgctcgccgctgcccggcctttattgtgcgctctcgcagccatgcccgct
aaactggatgcggccctggtagagccttaccgtaatctgctggtacgcgagatgcatctg
taccagacattatgcgatcaggcgaacctgcggcgcgagcacgtactggcggtacgttac
tgcctgtgtacggcgcttgatgaagccgccaataacacaacctggggacggcgcggcgtc
tgggccggaaaaagcctgctggtaacatttcatggtgaaagcgaaggcgggataaaactt
ttccagatcatcgggcgtctggcggccagcttccaggagcatggcaacgtactggaggtt
atctaccacctgctggggttgggatttgaaggccgctacagcgtgcagccagacgggcgt
aagcaactggacaatattcgccagcaactgctgacacagctttcacagcgtcgcgatccg
gttatgcccgcgctctcgcctgactttcagggggcgataagcggacgactgcggcggatg
cgccgggtgccggtctggctgagcgccgggatagccctgttggcgatgctgacgctgttt
ggcctttacagccaccggatggatgtgcagaccgtcaccgtacaacagcatattgatgcg
attggtataaaactgccgccgccgcctgtgccggttcataagctgcggctgaaaatcctg
ctggcaaacgaaatcgcccgtggcctgctgaccgtggacgaagatgaccagcacagtagg
gtggtcttccgtggcgacgccatgtttgtgccgggacagaaaacggtgagtgacgcaatc
cggccagtgattaacaaagcggcgcgggaaatcgcccgcgtgggcggcgcagtcactgta
acgggtcacactgacagccagcccattcattcggctgaattcccatccaacctggtactg
tcggaaaaacgggcggcggaagttgcggcgttgctgacctccggcggcgtacctgccgga
cgggtacatatcgtcggcaagggcgatacggtgccggtggcggataacggcagtaaagcc
gggcgggcgaaaaaccgtcgggtggaaattctggtagtggagtga

DBGET integrated database retrieval system