KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0423Help
Entry
STM0423           CDS       T00065                                 

Gene name
ispA
Definition
(RefSeq) (2E,6E)-farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00900  Terpenoid backbone biosynthesis
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
Module
stm_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STM0423 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:stm01006]
    STM0423 (ispA)
Enzymes [BR:stm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     STM0423 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     STM0423 (ispA)
Prenyltransferases [BR:stm01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   STM0423 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-GeneID: 1251942
NCBI-ProteinID: NP_459418
UniProt: Q8ZRD0
Position
complement(476517..477416)
Genome map
AA seq 299 aa AA seqDB search
MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGGKRLRPFLVYATGQMFG
VSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHIKFGEANAILAGDALQTL
AFAIISDAPMPEVADRDRIAMIAELANASGIAGMCGGQALDLAAEGQRITLDALERIHRH
KTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQLAAQSLDTSALEALANYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttacgcagcagctacaggcttgcgtaacgcaagcgaatcaggcgctgagccgt
tttatcgcgccactgccctttcagaacactcccgtggtcgaagccatgcagtatggcgca
ttattaggcggtaaacgcctgcggccatttctggtttacgccaccggtcaaatgtttggc
gtcagtacggcaacgctggatgcgccagctgcggcggtcgaatgcattcatgcctattcg
ctgatccatgacgacctgccagcaatggacgatgacgatttgcgtcgcggcctgccgact
tgccatattaaatttggcgaagccaacgcaatcctggcgggagacgcgttgcagacgctg
gcgtttgccattatcagcgacgcgccgatgccggaagtcgccgatcgcgatcgtatcgcg
atgatcgccgaactggcaaacgccagcggtatcgccggtatgtgcggcggtcaggcattg
gatctggcggcagaaggccagcggatcactctggacgcgctggaacgcattcatcgccat
aagaccggcgcgctcattcgcgccgccgttagacttggcgcattgagcgcgggcgataaa
ggacggaatactctgccgatacttgaccgctatgcagagagtatcggccttgccttccag
gttcaggatgacattctggatgtggtgggcgatactgcaacgttaggtaaacgtcagggc
gcagaccagcagcttggcaaaagtacctaccctgcacttctgggtcttgagcaagcccgg
aataaagcccgggacctgatagaggacgcccgtcagtcgttacatcagctggccgcgcaa
tcactggacacctcggcactggaagcgctagcgaactacataatccagcgtgataaataa

DBGET integrated database retrieval system