KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0428
Entry
STM0428           CDS       T00065                                 
Symbol
phnT
Name
(RefSeq) 2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT
  KO
K11084  2-aminoethylphosphonate transport system ATP-binding protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    STM0428 (phnT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM0428 (phnT)
Transporters [BR:stm02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   2-Aminoethylphosphonate transporter
    STM0428 (phnT)
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA_16 SMC_N AAA_30 AAA_22 AAA_29 AAA ABC_ATPase AAA_33 CbiA AAA_25 AAA_23 SRP54 TsaE T2SSE AAA_19 AAA_24 TrwB_AAD_bind Zeta_toxin Rad17 AAA_28 AAA_5 NB-ARC
Other DBs
NCBI-GeneID: 1251947
NCBI-ProteinID: NP_459423
UniProt: P96063
Position
complement(481024..482133)
AA seq 369 aa
MLMKTTTVHAPASQGTSGIVLDSLRVAYHGNVVLKPLSLTIEPGEVLALIGPSGSGKTTV
LRAVAGFVQPAGGRILIGDTDVTHLPPYKRGLAMVVQNYALFPHLKVEDNVAFGLRAQKQ
PKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIARAIAVRPRVLLLDEPLSALD
AQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLADKIGIMKDGSLIAHGETRALYQH
PPNRFAAEFLGRANILSAIALGITEAPGLVDVSCGGAVIRAFSRGSHHGYNKLLCIRPQH
LSLTPRSAYSNRFNATLQSVHWQGDLTHLLCDVAGETVRMVLTHVNPLPRVGDKLALWFE
PDDAVLIEV
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgctgatgaaaacgaccaccgttcacgcccctgcatcgcaggggacatcggggatagtc
ctcgactcgctgcgcgttgcgtatcacggcaacgtggtgcttaaaccgctctctttgacg
attgaacctggcgaagtgctggcgctgattggcccatcaggatctggaaaaacgacggtg
ctgcgtgcggttgcgggctttgtgcaacctgcaggcggtcgtattctgattggcgatacg
gacgtcacccatctgccaccctataaacgcgggttggcgatggtggtgcagaactacgcc
ttgttcccgcatctgaaagtggaagacaacgtcgcttttggcctgcgtgcgcagaagcag
ccaaaggcgctaattaatgagcgtgtaacgcaggcgctgaaaacggttggcatgagtgat
tacgccgcccgttatccgcatcaactttccggcggccagcagcaacgcgtggccatcgcc
cgcgcgattgccgtgcgcccgcgcgtgctgttgctggatgaaccactgtcagcgctggac
gcacagattcgtcataatatggtggaagaaatcgcccgtcttcaccgtgagctgccggaa
ctcactattctctacgtcacccacgatcaaacggaagcgctcactctggccgataaaatc
ggcattatgaaggatggctcgctgattgctcacggcgaaacccgcgcgctatatcagcat
ccgcccaatcgttttgccgccgaattcttaggtcgcgccaatattctctccgccatcgcg
ctggggataacggaggctccggggctggtggacgtcagctgcggcggtgcggtgattcgc
gcgttcagccggggcagccaccacggttacaacaaactgctgtgcattcgtcctcagcac
ctcagcctgacgccgcgttcggcctacagcaaccgcttcaacgccacactgcaatcggtg
cactggcagggcgatttaacccatctgctgtgtgacgttgctggcgaaacggtgcggatg
gtgttgacgcatgtcaatccgctgccgcgcgtgggcgacaagctggcgctgtggttcgaa
ccggatgatgcggtcctgattgaggtataa

DBGET integrated database retrieval system