KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM0934Help
Entry
STM0934           CDS       T00065                                 

Gene name
ltaA
Definition
(RefSeq) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00260  Glycine, serine and threonine metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STM0934 (ltaA)
Enzymes [BR:stm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     STM0934 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 1252453
NCBI-ProteinID: NP_459911
UniProt: Q8ZQF1
Position
complement(1009070..1010071)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMTAPVGDDVYGDDPTVNALQRYAADLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLENVAAKI
KADDIHFARTRLLSLENTHNGKVLPRAYLKDAWTFTRERGLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRATRWRKMVGGGMRQAGILAAAGLY
ALKHNVARLQEDHDNAAWLAQQLREAGAEVIRHETNMLFVRVGEAQAAALGDYLRERNIL
INAAPIVRLVTHLDVSREQLTDVVAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgggccgcgccatgctcgaggcgatg
atgaccgccccggtcggggacgacgtatacggcgatgaccctactgttaacgcccttcag
cgctacgccgccgacctttccggtaaagaagcggcgctttttttacccaccggcacccag
gccaatctggtcgcgctgcttagccattgtgaacgcggcgaagagtatatcgtcggtcag
ggcgcgcataattatctctatgaagctggcggcgcggcggtgctcggcagcattcagccg
cagcccatcgacgccgccgcggacggtacgctgccgctggagaacgtggcggcgaagatt
aaagcggatgacatccacttcgcgcgcacgcgcttgctcagtctggaaaatacgcataac
gggaaagtgctgccgcgcgcgtatctgaaagacgcctggacatttacccgcgaacgtgga
ctggcgctgcacgttgacggcgcccgaatttttaacgcggtggttgcctacggctgtgag
ttaaaagagattacgcagtattgcgactcttttaccatctgcctgtcaaaaggtctcgga
acgccggtcggttcactgctggtcggcaaccgcgattacattaaacgcgcgacgcgctgg
cgtaaaatggtcggcggcggaatgcgtcaggccgggattctggcagcggccggactgtat
gcgctgaagcataacgtggcgcgtctgcaagaggatcatgataacgccgcctggctggcg
cagcagcttcgggaagcgggcgcggaggtcatacgccacgaaacgaatatgctgtttgtt
cgcgttggcgaagcacaggccgccgcgcttggcgactatttgcgggaacggaatatcctg
attaacgccgcgccgattgtgcgtctggtgacgcatctggatgtctctcgcgaacagctt
accgacgtcgtcgcccactggcgcgcctttttagcccgctaa

DBGET integrated database retrieval system