KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1069
Entry
STM1069           CDS       T00065                                 

Gene name
ycbG
Definition
(RefSeq) Ter macrodomain-binding protein MatP
  KO
K09911  uncharacterized protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    STM1069 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-GeneID: 1252587
NCBI-ProteinID: NP_460043
UniProt: Q8ZQ68
Position
1160429..1160881
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYVEASAAQEAVNLLLALENEPVRVNVWIDR
HMNPALLNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETIV
QLIEDAEHKEKYATQMTTLKQDLQALLGKK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaaatatctggtgaaa
aagcaccgcgaaggggagctgatcacccgctacgtggaagccagtgctgcccaggaagcc
gtcaatttgttgttggccctcgaaaatgaaccggtgcgggtaaatgtctggatagacagg
catatgaatcctgccttgcttaatcggatgaaacaaaccattcgggcaagacgcaaacga
cacttcaatgcggaacatcagcatacgcgcaaaaaatctatcgatttagagtttatggtc
tggcagcgtctggcgggccttgcgcagcgacgcggtaaaacattatccgaaacgattgtg
caactgatagaagacgcggagcataaagagaaatatgccacgcaaatgaccacgttaaag
caggatttacaggcgttattaggcaagaagtaa

DBGET integrated database retrieval system