KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1182
Entry
STM1182           CDS       T00065                                 

Gene name
flgJ
Definition
(RefSeq) flagellar rod assembly protein/muramidase FlgJ
  KO
K02395  flagellar protein FlgJ
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:stm02035]
    STM1182 (flgJ)
Bacterial motility proteins [BR:stm02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    STM1182 (flgJ)
SSDB
Motif
Pfam: Glucosaminidase Rod-binding
Other DBs
NCBI-GeneID: 1252700
NCBI-ProteinID: NP_460153
UniProt: P15931
Structure
PDB: 
5DN4 5DN5

Position
1264443..1265393
AA seq 316 aa
MIGDGKLLASAAWDAQSLNELKAKAGQDPAANIRPVARQVEGMFVQMMLKSMREALPKDG
LFSSDQTRLYTSMYDQQIAQQMTAGKGLGLADMMVKQMTSGQTMPADDAPQVPLKFSLET
VNSYQNQALTQLVRKAIPKTPDSSDAPLSGDSKDFLARLSLPARLASEQSGVPHHLILAQ
AALESGWGQRQILRENGEPSYNVFGVKATASWKGPVTEITTTEYENGEAKKVKAKFRVYS
SYLEALSDYVALLTRNPRYAAVTTAATAEQGAVALQNAGYATDPNYARKLTSMIQQLKAM
SEKVSKTYSANLDNLF
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatcggagacggtaaattgctggccagcgcggcctgggatgcgcaatctctgaacgaa
ctgaaagcgaaagcgggccaggacccggcggcgaatatccgtcctgtggcccgtcaggtg
gaagggatgtttgtgcagatgatgctgaaaagtatgcgcgaggctttacccaaagatggt
ttattcagcagcgatcagacgcgtctgtataccagcatgtatgaccagcagatcgcccag
cagatgaccgccggtaagggattggggctggcggatatgatggttaaacagatgaccagc
gggcagacgatgcctgcggatgacgcgccgcaagtaccgcttaaattctccctggagacg
gtaaacagctatcaaaatcaggcgctgacccaactggtgcgcaaagccataccgaaaacg
ccggacagcagcgatgcgccgctctccggcgacagtaaagactttctggcccggctttcg
ctccctgcgaggctggccagcgaacaaagcggggtgccgcatcatctgattctggcgcag
gcggcactggagtccggctgggggcagcggcaaatcctgcgggagaatggcgaacccagc
tataacgtatttggcgtgaaagcgaccgccagttggaaagggccggtgacggagatcacc
accactgaatacgaaaatggcgaagcgaaaaaagtgaaagcgaaattccgcgtctatagc
tcgtatctggaggcattatcggattatgtcgcgctgttaacgcgtaacccacgctacgct
gccgtgaccactgccgccacggcagagcagggcgcagtggctctgcaaaacgccggatac
gccactgacccgaattacgcgcgtaaattgaccagcatgattcagcagttgaaagcgatg
agtgaaaaggtcagcaaaacctacagcgcgaatctcgacaatctcttttaa

DBGET integrated database retrieval system