KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1220Help
Entry
STM1220           CDS       T00065                                 

Gene name
ycfX
Definition
(RefSeq) N-acetylglucosamine kinase
  KO
K00884  N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00520  Amino sugar and nucleotide sugar metabolism
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STM1220 (ycfX)
Enzymes [BR:stm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     STM1220 (ycfX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-GeneID: 1252738
NCBI-ProteinID: NP_460190
UniProt: Q8ZPZ9
Structure
PDB: 

Position
1305835..1306746
Genome map
AA seq 303 aa AA seqDB search
MYYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDALTLMGFDFPLRRCGCG
QMGCIENYLSGRGFAWLYQHYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNI
LTIVDPDLLVIGGGLSNFTAITTQLAERLPRHLLPVARAPRIERARHGDAGGMRGAAFLH
LTD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtattacgggtttgacattggcggaacaaagattgcgttaggcgtatttgactcaacg
cggcggctgcagtgggaaaaacgggttcccacgccccataccagctatagcgccttttta
gacgccgtatgcgaactggtcgaggaagccgaccagcgatttggcgtaaaagggtcggta
gggattggcatacccggtatgccggaaaccgaagacggcacgctgtacgccgcgaatgtc
ccggcagccagcggtaagccgttgcgcgccgatctcagcgcccgactggatcgcgatgtg
cgtctggacaatgacgctaactgttttgccttgtccgaagcctgggatgatgaattcacg
caatatcctttggttatggggcttatcctcggcaccggcgtcggcggtggcctggtgcta
aacgggaagccgattaccggtcagagctatatcaccggcgagtttggtcatatgcgtttg
ccggttgacgcgctaacgttgatggggtttgattttcctctccgccgttgtggatgcggt
cagatgggctgcattgagaattatctgtccgggcgcgggtttgcgtggctatatcagcat
tattatgatcaatcgctgcaggcgccggagattatcgcgttgtgggagcagggcgatgag
caggcgcacgcgcatgttgagcgctatctggatttactggcggtttgtctggggaatata
ctgacgattgtcgatcccgatttattggtgatcggcggcggactatcgaactttacggca
ataacaacgcaactggcggaaagactgccgcgccatctcctccctgttgcccgcgcgccg
cgcattgagcgtgcgcggcatggggatgcaggtgggatgcgcggtgctgcttttttacat
cttaccgactaa

DBGET integrated database retrieval system