KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1574
Entry
STM1574           CDS       T00065                                 
Symbol
smvA
Name
(RefSeq) MFS transporter
  KO
K08167  MFS transporter, DHA2 family, multidrug resistance protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM1574 (smvA)
   01504 Antimicrobial resistance genes [BR:stm01504]
    STM1574 (smvA)
Transporters [BR:stm02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    STM1574 (smvA)
Antimicrobial resistance genes [BR:stm01504]
 Gene variants
  Quinolone resistance genes
   Transporter
    STM1574 (smvA)
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump QacA [MD:M00714]
    STM1574 (smvA)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 1253092
NCBI-ProteinID: NP_460533
UniProt: P37594
Position
complement(1656803..1658290)
AA seq 495 aa
MFRQWLTLVIIVLVYIPVAIDATVLHVAAPTLSMTLGASGNELLWIIDIYSLVMAGMVLP
MGALGDRIGFKRLLMLGGTLFGLASLAAAFSHTASWLIATRVLLAIGAAMIVPATLAGIR
ATFCEEKHRNMALGVWAAVGSGGAAFGPLIGGILLEHFYWGSVFLINVPIVLVVMGLTAR
YVPRQAGRRDQPLNLGHAVMLIIAILLLVYSAKTALKGHLSLWVISFTLLTGALLLGLFI
RTQLATSRPMIDMRLFTHRIILSGVVMAMTAMITLVGFELLMAQELQFVHGLSPYEAGVF
MLPVMVASGFSGPIAGVLVSRLGLRLVATGGMALSALSFYGLAMTDFSTQQWQAWGLMAL
LGFSAASALLASTSAIMAAAPAEKAAAAGAIETMAYELGAGLGIAIFGLLLSRSFSASIR
LPAGLEAQEIARASSSMGEAVQLANSLPPTQGQAILDAARHAFIWSHSVALSSAGSMLLL
LAVGMWFSLAKAQRR
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgtttcgtcagtggttaacgttagtcattattgtgctggtctatattcctgtcgccatt
gatgccacggtcttgcatgtcgccgcgccgacactgagtatgacactgggggccagcggc
aacgagctgctgtggatcattgatatttattctttggtcatggctggcatggtgttgccg
atgggcgcacttggcgatcgtatcggttttaaacgcctgctgatgctgggcgggacgctc
tttggcctggcgtcattggcggcagcgttttcgcataccgccagttggcttatcgccacc
agggtattactggctattggcgcggcgatgattgtaccggcgacgctggccggaatacgc
gctaccttttgtgaagagaagcatcgcaacatggcgctgggcgtctgggcagcggtaggt
tcgggcggagcggcgtttgggccgctcatcggcggcatattattagagcatttttactgg
ggatcggttttcctgatcaacgtgccgattgtgctggtcgtcatgggcttaaccgcccgc
tatgttcctcgccaggcgggccgtcgcgatcaaccgctcaatcttggccatgcggtgatg
ctgattattgccattttgctgttggtctatagcgctaaaaccgcgctgaaagggcatctg
tcgctgtgggttatctcgtttaccctgcttaccggcgcgctgctcctgggactctttatc
cgcacacagcttgcgacatcgcgtccgatgattgatatgcgactatttacccatcgcatt
atcctgagcggcgtcgtgatggcgatgaccgcgatgatcactctggtgggttttgagctg
ctgatggcgcaagagctgcagtttgttcacgggctatcgccttatgaggccggggtattt
atgctgccggtaatggtcgccagtggattcagcgggccgattgcgggcgtgctggtctcg
cgtctgggactacggctggtcgcgacgggcggcatggcgttaagcgcgctgagtttttat
ggcctggcgatgacggatttcagcacccaacaatggcaggcctgggggctgatggcgctg
ctgggatttagcgccgccagcgcattgctggcttccacgtcggcaattatggccgctgcg
ccggcagaaaaagcggcggcggccggcgcgatagaaacgatggcttatgaactgggcgcg
ggactgggcattgccattttcggtctgttgttaagccgtagcttctccgcgtctatccgt
ctgcctgccgggcttgaggcgcaagagattgccagagcgtcatcttcaatgggagaagcc
gtgcagttggcgaatagcctaccgcccacgcaggggcaggcaatactggacgccgccaga
catgcctttatctggtcgcatagcgtggcgttaagcagcgccgggagtatgcttcttttg
ctggcggtagggatgtggttcagcctggcaaaagcccaacgccgataa

DBGET integrated database retrieval system