KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1656
Entry
STM1656           CDS       T00065                                 

Name
(RefSeq) zinc transporter ZntB
  KO
K16074  zinc transporter
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM1656
Transporters [BR:stm02000]
 Other transporters
  Pores ion channels [TC:1]
   STM1656
SSDB
Motif
Pfam: CorA
Other DBs
NCBI-GeneID: 1253174
NCBI-ProteinID: NP_460615
UniProt: Q9EYX5
Structure
PDB: 
3NVO 3NWI

Position
complement(1750142..1751125)
AA seq 327 aa
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP
LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR
QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ
IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE
IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR
FGFSLFCILLVVLIGGVTLWLHRSKWL
NT seq 984 nt   +upstreamnt  +downstreamnt
gtggaagccattaagggatcggatgtgaacgtgccggatgccgttttcgcatggctactg
gatggtcgtggtggagtaaaaccgctcgaagataatgatgtgatcgatagtcagcatccc
tgttggctacatcttaattatacccacccggacagcgcccgctggttggcttcaacgcct
ttactccccaataacgtgcgtgatgcgctggctggtgaaagctcgcgcccgcgcgtaagt
cgtatgggggaagggacgctcattacgctgcgctgtattaatggcagtactgacgaacgc
ccggatcaattagtggcaatgcgtttatatatggacgagcgattcattgtgtctacccgt
cagcgaaaggttctggcgctggacgatgtggtcagtgatttgcaggagggcaccgggccc
gtagattgcggcggctggttagtggatgtgtgcgatgcgttaaccgatcacgccagtgaa
tttattgaagagctacacgataaaattatcgatctggaagataatcttctcgaccagcaa
atcccaccgcgcggtttcctcgcattgctacgtaaacagctaattgttatgcgccgctat
atggcgccgcagcgcgacgtctatgcccggcttgcgagtgaacggctgccgtggatgagc
gacgatcaccggcgcagaatgcaggatatcgccgacaggctgggaagggggttggatgaa
attgacgcttgtatcgcgcgtactggcatcatggcggatgaaattgcccaggtgatgcag
gagtctctggcgcgcagaacttataccatgtcgcttatggcgatggtttttctgcccagc
accttcttaacggggttatttggcgttaacctgggcggtattcccggcggcggatggcgg
ttcggcttttctctgttttgtattctgttagttgtcctgatcggtggtgttactttatgg
ttgcatcgcagtaaatggttgtaa

DBGET integrated database retrieval system