KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1711Help
Entry
STM1711           CDS       T00065                                 

Gene name
ribA
Definition
(RefSeq) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00740  Riboflavin metabolism
stm00790  Folate biosynthesis
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm02024  Quorum sensing
Module
stm_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    STM1711 (ribA)
   00790 Folate biosynthesis
    STM1711 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    STM1711 (ribA)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     STM1711 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 1253230
NCBI-ProteinID: NP_460670
UniProt: P66030
Position
1804103..1804693
Genome map
AA seq 196 aa AA seqDB search
MQLKRVAEAKLPTPLGDFLMVGFEELATGHDHAALVFGDISGKTPVLARVHSECLTGDAL
FSLRCDCGFQLEAALTHIAEEGRGILIYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLGVDEVRLLTNNPKKVEILTEAGINIVERVPLIVGRNPNNE
HYLDTKAAKMGHLLSK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaaacgtgtggcagaagccaaactgccaaccccattgggtgactttctgatg
gtgggatttgaagaactggcaaccggacacgaccatgccgcgctggtttttggcgatatt
tcaggtaaaacgccggtactggctcgcgttcattccgaatgtcttaccggggacgcgctt
tttagtctgcgctgtgattgtggttttcaactggaagccgcgctgacgcatattgcggaa
gaaggacgcggtattctgatttaccaccgtcaggaaggccgcaatatcggcctgcttaat
aaaattcgcgcttatgcgttacaggatcaaggctatgacacggtggaggccaatcatcag
ctcggctttgccgccgatgagcgtgatttcaccctttgcgcggatatgttcaaattactc
ggcgtggatgaagttcgcctgctgaccaataatccgaagaaagtcgaaatactgaccgag
gcgggaattaatatcgtggaacgcgttccgctcattgtgggtcgtaatccaaataatgag
cattatctcgatactaaagcggccaaaatgggccacctactaagtaagtaa

DBGET integrated database retrieval system