KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1862
Entry
STM1862           CDS       T00065                                 

Symbol
pagO
Name
(RefSeq) EamA family transporter
  KO
K07790  putative membrane protein PagO
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STM1862 (pagO)
SSDB
Motif
Pfam: EamA Multi_Drug_Res
Other DBs
NCBI-GeneID: 1253381
NCBI-ProteinID: NP_460818
UniProt: O30646
Position
1959504..1960418
AA seq 304 aa
MRKVSISILFMLVSLTWGTTWLAMRIAVETIPPVFATGMRFMFAAPFLIIIAWLRKKTLL
FPPGQRLFQFVICIFYFCIPFSLMIYGETYVNSGLAAIIFANMPVAVLIASVLFLNEKAK
LMQIAGLTIAITALTGILLEETNTSTESHWQGITALISAVLIHAIIYTQCKKRSCTVSVI
TFNALPCLLAGLILSATGWFFERPQVSTFSVHSILATLYLGAFAGVFGILCYFALQQKAN
AFQASLVFLIFPLIAVSLEDYIYGYAISTHSMLLIIPLVIGIFLTLVARNLPVTSRCRDN
SSQK
NT seq 915 nt   +upstreamnt  +downstreamnt
atgcgcaaggtgtcgatatctatattattcatgctagtttcactgacttgggggactaca
tggttggccatgcgaattgccgttgaaactatccctccagtgtttgcaaccggaatgagg
tttatgtttgcagcaccttttttaatcatcattgcatggttaagaaaaaaaacactgttg
tttcctcccggacaacgattattccagtttgtgatatgcatcttttatttttgcattcct
ttctcactaatgatttatggtgaaacctatgtcaactctgggcttgccgccattatcttt
gcgaatatgcctgtggccgttttgatagcatcggttttgtttctaaatgaaaaagcgaaa
ctaatgcagatcgcgggcttaactatcgcaatcactgcattgacggggatacttcttgaa
gaaacgaatacaagtacagagagtcactggcagggtatcactgcgcttatttctgctgtg
ttaatccatgccataatatatacacaatgtaagaaaagaagttgtactgtctctgttatc
acatttaatgcgctcccgtgccttttagctgggttgatactttctgcgacaggatggttt
tttgaaagaccacaagtatcaaccttctcagtacactcaatattagctaccctgtatctc
ggggcttttgccggagtttttggtatcctgtgctactttgcgcttcagcaaaaggctaat
gccttccaggcttcgcttgtatttcttatctttccgctgattgcggtaagtctggaagac
tatatttatggatatgctatttcaacacactcaatgctgcttattataccattagttatc
gggatatttcttactcttgtcgccagaaatctccctgtaaccagcagatgccgggataac
tcatcacagaaataa

DBGET integrated database retrieval system