KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2076
Entry
STM2076           CDS       T00065                                 

Gene name
hisA
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00340  Histidine metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01230  Biosynthesis of amino acids
Module
stm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    STM2076 (hisA)
Enzymes [BR:stm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     STM2076 (hisA)
SSDB
Motif
Pfam: His_biosynth Dus NMO PEP_mutase Trp_syntA IGPS TMP-TENI NanE ThiG G3P_antiterm IMPDH
Other DBs
NCBI-GeneID: 1253597
NCBI-ProteinID: NP_461021
UniProt: P10372
Structure
PDB: 

Position
2154648..2155385
AA seq 245 aa
MIIPALDLIDGTVVRLHQGDYARQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKR
QIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFG
AQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISRDGTLA
GSNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQ
CWQNV
NT seq 738 nt   +upstreamnt  +downstreamnt
atgattattccggcattagatttaattgacggcaccgtggtgcgtctccaccagggtgac
tacgcccggcagcgggattacggtaacgatcccctgccccgtttgcaggattacgccgcc
cagggcgccggggtgctgcatctggtagatctgaccggcgctaaagatccggctaagcga
cagataccgctgattaaaaccctggtcgcgggcgtgaacgtgcctgttcaggtcggcggc
ggcgtgcgtaccgaagaagacgttgcggcattactgaaagctggcgttgcccgtgtggtc
atcggttcaacggcggtgaaatcccctgacgtggtgaaaggctggtttgaacgttttggc
gcgcaggcgctggtactggcgctagacgttcgcatagacgaacacggcaccaagcaggtg
gcggttagcggctggcaggaaaattccggtgtctcgctggaacaactggtggagacctat
ctccccgtcggcctgaaacatgtactgtgtaccgatatttctcgcgacggcacgctggcg
ggctctaacgtttcgctgtacgaagaggtatgcgccagatatccgcagatcgcctttcaa
tcctccggcggtattggcgatatcgatgatattgccgccctgcgcggcaccggcgtgcgc
ggcgtgattgtcggacgcgcgctgttggaagggaaatttaccgttaaggaggccatccaa
tgctggcaaaacgtataa

DBGET integrated database retrieval system